BQ623594

Overview
NameBQ623594
Unique NameBQ623594
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length427
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2221 contig Csv1_Contig2221:826..1252. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y1518_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.927e-18
Identity = 51/118 (43.22%), Postives = 72/118 (61.02%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            ++HRD+K++N+L+ +   AK+ADF LS   P       ST V GT GY  PEY  T  L+ KSDVYSFGVVLLE++T +  +D T  R +  +  W    L++  ++  VD +L GDY
Sbjct:  704 MVHRDVKTTNILLNERCGAKLADFGLSRSFPIDGECHVSTVVAGTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIVTNQPVIDKT--RERPHINDWVGFMLTKGDIKSIVDPKLMGDY 819          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAKLI_ARATH (Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.927e-18
Identity = 48/114 (42.11%), Postives = 68/114 (59.65%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            + HRD+K++N+L+ +   AK++DF  S         L +T V GTFGY  PEY  T Q   KSDVYSFGVVL+EL+TG KP     P   + LV+     + +++V   VD+R+
Sbjct:  542 VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHL-TTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRI 654          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAK1_ARATH (Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.927e-18
Identity = 53/117 (45.30%), Postives = 72/117 (61.54%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGD 356
            IIHRDIK++N+L+  +  AK+ADF  S   P     L  T V GT GY  PEY  TG LN KSDVYSFGVVL+ELL+G+K +    P+  + LV++      E++    +D  +GG+
Sbjct:  530 IIHRDIKTANILLDVNLTAKVADFGASRLIPMDKEELE-TMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFKRPQSSKHLVSYFATATKENR----LDEIIGGE 641          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.927e-18
Identity = 49/116 (42.24%), Postives = 68/116 (58.62%), Query Frame = 3
Query:    3 HIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLH-STRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARL 347
            HI+HRDIKSSN+L+  +  A +ADF LS     +  R H +T ++GT GY  PEY        + DVYSFGVV+LELLTG++P++   P+  + LV W      + K  +  D  L
Sbjct:  924 HIVHRDIKSSNILLDGNFKAYVADFGLSRLI--LPYRTHVTTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMSRELVAWVHTMKRDGKPEEVFDTLL 1037          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK16_ARATH (Putative cysteine-rich receptor-like protein kinase 16 OS=Arabidopsis thaliana GN=CRK16 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 4.927e-18
Identity = 51/136 (37.50%), Postives = 72/136 (52.94%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVD-HTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+ N+L+  D   KIADF ++           + RV+GTFGY  PEY   GQ + KSDVYSFGV++LE++ G+K    H +     +LVT+     + +   + VD  +G  Y             LCVQ
Sbjct:  456 IIHRDLKAGNILLDVDMNPKIADFGVARNFRVDQTEATTGRVVGTFGYMPPEYVANGQFSMKSDVYSFGVLILEIIVGKKSSSFHEIDGSVGNLVTYVWRLWNNESFLELVDPAMGESYDKDEVIRCIHISLLCVQ 591          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: Y5188_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.435e-18
Identity = 50/118 (42.37%), Postives = 71/118 (60.17%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            ++HRD+K++N+L+ +   AK+ADF LS   P       ST V GT GY  PEY  T  L+ KSDVYSFGVVLLE++T +   D T  R +  +  W    L++  ++  +D +L GDY
Sbjct:  686 MVHRDVKTTNILLNERYGAKLADFGLSRSFPVDGESHVSTVVAGTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIVTNQPVTDKT--RERTHINEWVGSMLTKGDIKSILDPKLMGDY 801          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: WAKLS_ARATH (Putative wall-associated receptor kinase-like 16 OS=Arabidopsis thaliana GN=WAKL16 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.435e-18
Identity = 49/111 (44.14%), Postives = 70/111 (63.06%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVD 338
            IIHRDIK+ N+L+ ++  AK+ADF  S   P    +L +T V GT GY  PEY  T  LN KSDVYSFGVVL+EL++G+K +    P   + LV++      E+++ + +D
Sbjct:  229 IIHRDIKTENILLDENLTAKVADFGASKLKPMDKEQL-TTMVQGTLGYLDPEYYTTWLLNEKSDVYSFGVVLMELISGQKALCFERPETSKHLVSYFVLATKENRLHEIID 338          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: RLK6_ARATH (Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.435e-18
Identity = 48/118 (40.68%), Postives = 72/118 (61.02%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDY 359
            ++HRD+K++N+L+ +   AK+ADF LS   P       ST V GT GY  PEY  T  LN KSDVYSFG+VLLE++T +  ++ +  R +  +  W    L++  ++  +D +L GDY
Sbjct:  713 MVHRDVKTTNILLNEHLHAKLADFGLSRSFPIEGETHVSTVVAGTPGYLDPEYYRTNWLNEKSDVYSFGIVLLEIITNQLVINQS--REKPHIAEWVGLMLTKGDIQNIMDPKLYGDY 828          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK15_ARATH (Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana GN=CRK15 PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 6.435e-18
Identity = 53/135 (39.26%), Postives = 75/135 (55.56%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   K+ADF L+        + +++R++GTFGY APEYA+ GQ + KSDVYSFGV++LE+++G+K        G   LVT A    S       VD  +  +              LCVQ
Sbjct:  458 IIHRDLKASNILLDADMNPKLADFGLARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLVLEIISGKKNNSFYETDGAHDLVTHAWRLWSNGTALDLVDPIIIDNCQKSEVVRCIHICLLCVQ 592          
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 6.435e-18
Identity = 51/135 (37.78%), Postives = 77/135 (57.04%), Query Frame = 3
Query:    6 IIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVRQCVDARLGGDYPPXXXXXXXXXXXLCVQ 410
            IIHRD+K+SN+L+  D   KIADF ++          +++R++GT+GY +PEYAM GQ + KSDVYSFGV++LE+++G+K        G   LV++A    S  +  + VD  +  +              LCVQ
Sbjct:  458 IIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLLCVQ 592          
The following BLAST results are available for this feature:
BLAST of BQ623594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 246
Match NameE-valueIdentityDescription
Y1518_ARATH4.927e-1843.22Probable LRR receptor-like serine/threonine-protei... [more]
WAKLI_ARATH4.927e-1842.11Wall-associated receptor kinase-like 22 OS=Arabido... [more]
WAK1_ARATH4.927e-1845.30Wall-associated receptor kinase 1 OS=Arabidopsis t... [more]
PSYR1_ARATH4.927e-1842.24Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
CRK16_ARATH4.927e-1837.50Putative cysteine-rich receptor-like protein kinas... [more]
Y5188_ARATH6.435e-1842.37Probable LRR receptor-like serine/threonine-protei... [more]
WAKLS_ARATH6.435e-1844.14Putative wall-associated receptor kinase-like 16 O... [more]
RLK6_ARATH6.435e-1840.68Receptor-like protein kinase At3g21340 OS=Arabidop... [more]
CRK15_ARATH6.435e-1839.26Cysteine-rich receptor-like protein kinase 15 OS=A... [more]
CRK10_ARATH6.435e-1837.78Cysteine-rich receptor-like protein kinase 10 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00685 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00685 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623594 ID=BQ623594|Name=BQ623594|organism=Citrus sinensis|type=EST|length=427bp
CTCATATTATCCATCGCGATATTAAGTCCAGCAATGTACTAATTTTTGAT
GATGATGTAGCAAAGATTGCCGACTTTGATTTATCTAATCAAGCTCCTGA
TATGGCAGCTCGCCTTCATTCTACTCGTGTTCTTGGAACTTTTGGTTATC
ATGCTCCTGAGTATGCAATGACTGGACAGTTGAATGCAAAGAGTGATGTA
TACAGCTTTGGTGTTGTTCTGCTTGAGCTTCTGACAGGTCGAAAACCTGT
CGATCATACACTACCACGTGGACAGCAGAGTCTAGTGACATGGGCCACAC
CGAAACTTAGTGAAGATAAGGTTAGGCAATGCGTTGATGCAAGACTAGGA
GGAGATTATCCTCCCAAGGCAGTTGCAAAGATGGCTGCAGTTGCTGCTCT
GTGTGTTCAGTATGAAGCTGATTTCCG
back to top