BQ623644
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623644 vs. ExPASy Swiss-Prot
Match: CP24A_RAT (1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 8.636e-11 Identity = 29/88 (32.95%), Postives = 53/88 (60.23%), Query Frame = 3 Query: 111 IGGFKVPRGTMLLVNSWAIQNDPRIWEEPSKFKPERFREMAGKSDKYMLLPFGTGRRVCPGEGLAMRLVGLALGSLVQCFEWVRTGGD 374 +G + +P+GT+L +N+ + + +E+ KF+PER+ + K + + LPFG G+R+C G LA + LAL ++Q ++ V T + Sbjct: 404 LGEYALPKGTVLTLNTQVLGSSEDNFEDSHKFRPERWLQKEKKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVATDNE 491 HSP 2 Score: 27.7202 bits (60), Expect = 8.636e-11 Identity = 10/23 (43.48%), Postives = 16/23 (69.57%), Query Frame = 2 Query: 5 DLTALPYLHGVIKETLRMYPAAP 73 DL +PYL +KE++R+ P+ P Sbjct: 370 DLRNMPYLKACLKESMRLTPSVP 392
BLAST of BQ623644 vs. ExPASy Swiss-Prot
Match: C518A_DICDI (Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518a1 PE=3 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 8.647e-11 Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 3 Query: 114 GGFKVPRGTMLLVNSWAIQNDPRIWEEPSKFKPERFREMAGKSDKYMLLPFGTGRRVCPGEGLAMRLVGLALGSLVQCFE 353 G K+P+GT ++ + ++I D W+ P +FKPERF + S+ Y P+G G + C G G + + ++L +LV F+ Sbjct: 383 GSLKIPKGTQIIQSLYSIFRDENYWDSPDQFKPERFLDQDSHSNNY--FPYGIGVKNCIGMGFSQDELYISLSNLVLNFK 460 HSP 2 Score: 28.1054 bits (61), Expect = 8.647e-11 Identity = 11/33 (33.33%), Postives = 18/33 (54.55%), Query Frame = 2 Query: 2 SDLTALPYLHGVIKETLRMYPAAPLLVPHESSE 100 S+ P + +KE LR+YP P VP + ++ Sbjct: 344 SNRNQTPLFNAALKEVLRLYPPVPFGVPRQVNQ 376 The following BLAST results are available for this feature:
BLAST of BQ623644 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 262
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623644 ID=BQ623644; Name=BQ623644; organism=Citrus sinensis; type=EST; length=421bpback to top |