BQ623654
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623654 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 5.562e-14 Identity = 37/61 (60.66%), Postives = 45/61 (73.77%), Query Frame = 3 Query: 3 GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 185 G FDPLGLA DPE A+L++ EIK+ RLAM + GF VQA TGKGPL N A HL+DP++ Sbjct: 220 GKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of BQ623654 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.605e-13 Identity = 36/61 (59.02%), Postives = 43/61 (70.49%), Query Frame = 3 Query: 3 GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVN 185 G FDPLGLA DP A+L++ EIK+ RLAM GF VQA TGKGPL N A HL+DP++ Sbjct: 217 GKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277
BLAST of BQ623654 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 5.756e-11 Identity = 35/62 (56.45%), Postives = 40/62 (64.52%), Query Frame = 3 Query: 3 GGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNN 188 GG F+PL A EA K KE+ NGRLAM + GF VQ VTGKGP ENL HL+DP +N Sbjct: 187 GGIFNPLNFAPTQEA----KEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHN 244 The following BLAST results are available for this feature:
BLAST of BQ623654 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623654 ID=BQ623654; Name=BQ623654; organism=Citrus sinensis; type=EST; length=304bpback to top |