BQ623772
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 4.033e-12 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 1 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 105 TPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 4.033e-12 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 1 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 105 TPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.033e-12 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 1 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 105 TPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 476 TPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.174e-11 Identity = 31/35 (88.57%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 1 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 105 TPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K Sbjct: 477 TPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3) HSP 1 Score: 68.5514 bits (166), Expect = 1.174e-11 Identity = 31/35 (88.57%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 1 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 105 TPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K Sbjct: 477 TPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511 The following BLAST results are available for this feature:
BLAST of BQ623772 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623772 ID=BQ623772; Name=BQ623772; organism=Citrus sinensis; type=EST; length=350bpback to top |