CB250300

Overview
NameCB250300
Unique NameCB250300
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length437
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10169 contig Csv1_Contig10169:164..600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_WOLSU (Arginine biosynthesis bifunctional protein argJ OS=Wolinella succinogenes GN=argJ PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.943e-13
Identity = 43/109 (39.45%), Postives = 57/109 (52.29%), Query Frame = 1
Query:   73 EAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAV 399
            E +     L+ VM  LA   A DGEGA  L+   V+GA SE EA K               +G DPNWGRIA+  G +GV   +N+LR+  G+ L+ D G  L FD+ +
Sbjct:  243 EEEAFLMALERVMHKLATDVARDGEGAKKLVAFEVSGAASEEEAIKAAKALTTSLLVKTAIFGEDPNWGRIASTIGSSGVECDENRLRISFGEVLVYDRGAIL-FDKTI 350          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACLD (Arginine biosynthesis bifunctional protein argJ OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=argJ PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.943e-13
Identity = 43/109 (39.45%), Postives = 51/109 (46.79%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRKA 423
            L +V   LAK  A DGEGAT LIEV V GA S  EA  I              YG D NWGRI  A G +  +    K+ + LG   L    +P PF   +A  YL  +
Sbjct:  263 LQLVCTDLAKQIARDGEGATKLIEVEVNGAKSNLEAQIIAKKIVGSNLVKTAVYGTDANWGRIVVAIGDSMAAVTPEKVEIRLGGQCLFKNNEPQPFSEELAKTYLENS 371          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_STRT1 (Arginine biosynthesis bifunctional protein argJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.725e-13
Identity = 42/109 (38.53%), Postives = 55/109 (50.46%), Query Frame = 1
Query:   64 DCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFD 390
            D  E  +    L+ VMQ LAK  A DGEGA  LI+V V  A +  +A  +              +G DPNWGRI AA GYAGV    + + ++LG   +M    P+ FD
Sbjct:  243 DTPEFDKFSKMLNFVMQELAKKIAKDGEGANKLIQVDVVNAPNALDARMMAKSVVGSSLVKTAIFGEDPNWGRILAAVGYAGVDVPVDNVDIMLGGLPVMLASSPVTFD 351          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_DEHSC (Arginine biosynthesis bifunctional protein argJ OS=Dehalococcoides sp. (strain CBDB1) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.783e-13
Identity = 44/111 (39.64%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   88 QACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRK 420
            Q  L +V Q LAKS A DGEGA  LIE++V GA +  +A  I              +G DPNWGRI AAAG AG  F  + + + LG+S ++  G     D     ++LR+
Sbjct:  259 QQALTIVCQNLAKSIARDGEGAKRLIEIQVEGAANLEDARLIARVIAGSPLVKTAVHGADPNWGRILAAAGRAGADFDIDMVDLYLGESPVLLKGARTGVDEKELSSWLRQ 369          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_STRT2 (Arginine biosynthesis bifunctional protein argJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.147e-12
Identity = 41/109 (37.61%), Postives = 55/109 (50.46%), Query Frame = 1
Query:   64 DCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFD 390
            D  E  +    L+ VMQ LAK  A DGEGA  LI+V V  A +  +A  +              +G DPNWGRI AA GYAGV    + + +++G   +M    P+ FD
Sbjct:  243 DTPEFDKFSKMLNFVMQELAKKIAKDGEGANKLIQVDVVNAPNALDARMMAKSVVGSSLVKTAIFGEDPNWGRILAAVGYAGVDVPVDNVDIMIGGLPVMLASSPVTFD 351          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_STAES (Arginine biosynthesis bifunctional protein argJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.147e-12
Identity = 41/110 (37.27%), Postives = 57/110 (51.82%), Query Frame = 1
Query:   64 DCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDR 393
            D  +  + +  L  +M  LAKS A DGEGA+ LIEV V GA   + A  I              +G DPNWGRI AAAGYA   F  N++ + +G   ++    P+ +D+
Sbjct:  243 DSEDYYKFKQMLLYIMTDLAKSIARDGEGASKLIEVTVKGAKESSAARMIAKSVVGSSLVKTAIFGEDPNWGRIIAAAGYAKTYFDINQVDIFIGRIPVLIRSSPVKYDK 352          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_STAEQ (Arginine biosynthesis bifunctional protein argJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.147e-12
Identity = 41/110 (37.27%), Postives = 57/110 (51.82%), Query Frame = 1
Query:   64 DCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDR 393
            D  +  + +  L  +M  LAKS A DGEGA+ LIEV V GA   + A  I              +G DPNWGRI AAAGYA   F  N++ + +G   ++    P+ +D+
Sbjct:  243 DSEDYYKFKQMLLYIMTDLAKSIARDGEGASKLIEVTVKGAKESSAARMIAKSVVGSSLVKTAIFGEDPNWGRIIAAAGYAKTYFDINQVDIFIGRIPVLIRSSPVKYDK 352          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACSK (Arginine biosynthesis bifunctional protein argJ OS=Bacillus clausii (strain KSM-K16) GN=argJ PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.147e-12
Identity = 39/106 (36.79%), Postives = 54/106 (50.94%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYL 414
            L    + LAK  A DGEGAT LIEV+V GA S+ EA K+              YG+D NWGRI  A GY+G +   + + + +G    +   +P+  D A    Y+
Sbjct:  265 LSACAESLAKKIAKDGEGATKLIEVQVAGAVSDEEAGKVAKAIVGSDLVKTAAYGKDGNWGRIICAIGYSGCTLDPDTIDIAIGPYETLVQSEPVVVDDAAISKYM 370          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACSU (Arginine biosynthesis bifunctional protein argJ OS=Bacillus subtilis GN=argJ PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.338e-12
Identity = 38/101 (37.62%), Postives = 49/101 (48.51%), Query Frame = 1
Query:  112 QGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYL 414
            + LAK  A DGEGAT LIE +V GA +  +A  I              YG D NWGRI  A G++       ++ V LG   L    +P PF  ++A  YL
Sbjct:  268 EDLAKEIARDGEGATKLIEAQVQGAKNNLDANVIAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFSESIAKEYL 368          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACAM (Arginine biosynthesis bifunctional protein argJ OS=Bacillus amyloliquefaciens GN=argJ PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.338e-12
Identity = 38/101 (37.62%), Postives = 49/101 (48.51%), Query Frame = 1
Query:  112 QGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYL 414
            + LAK  A DGEGAT LIE +V GA +  +A  I              YG D NWGRI  A G++       ++ V LG   L    +P PF  ++A  YL
Sbjct:  268 EDLAKEIARDGEGATKLIEAQVQGAKNNLDANVIAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFSESIAKEYL 368          
The following BLAST results are available for this feature:
BLAST of CB250300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
ARGJ_WOLSU3.943e-1339.45Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACLD3.943e-1339.45Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_STRT16.725e-1338.53Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_DEHSC8.783e-1339.64Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_STRT21.147e-1237.61Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_STAES1.147e-1237.27Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_STAEQ1.147e-1237.27Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACSK1.147e-1236.79Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACSU3.338e-1237.62Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACAM3.338e-1237.62Arginine biosynthesis bifunctional protein argJ OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0079 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ107 similar to putative glutamate/ornithine acetyltransferase (acc# NP_565863), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250300 ID=CB250300|Name=CB250300|organism=Citrus sinensis|type=EST|length=437bp
ACCAATGATACTGTCATAGCTTTGGCTAGTGGGTTATCTAGATCAAGCAG
GTTATCTTCTGTTGACTGTAACGAAGCCAAGCAACTTCAAGCATGCCTTG
ATGTGGTAATGCAAGGTCTTGCCAAGTCTACAGCTTGGGATGGAGAAGGA
GCAACGTGCTTAATTGAGGTCAGAGTGACCGGTGCTAACAGTGAGGCTGA
AGCAGCCAAGATCGCCCGCTCAGTGGCATCTTCTTCACTTGTCAAGGCAG
CTGTATACGGCAGAGATCCGAACTGGGGACGCATTGCTGCAGCTGCTGGA
TATGCAGGGGTTTCTTTCTACCAAAACAAGCTCCGCGTATTGCTTGGAGA
TAGTTTGCTCATGGATGGTGGGCAACCACTCCCATTTGACAGGGCTGTGG
CTGGTAACTATCTCAGGAAGGCTGGTGAGACCCGCGG
back to top