CB250300

Overview
NameCB250300
Unique NameCB250300
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length437
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10169 contig Csv1_Contig10169:164..600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_RHOBA (Arginine biosynthesis bifunctional protein argJ OS=Rhodopirellula baltica GN=argJ PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.359e-12
Identity = 45/143 (31.47%), Postives = 60/143 (41.96%), Query Frame = 1
Query:    1 TNDTVIXXXXXXXXXXXXXXVDCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRKAGE 429
            TNDTV+               + +E K  Q     V   LAK    DGEGA    EVRV+GA  + +A  I               G DPNWGRI +AAGYAG      +  +++    + + G PL  D A     ++   E
Sbjct:  234 TNDTVMLVCTGMSVSEDAKEFNSDELKIWQEAATQVALKLAKMLVADGEGAARFFEVRVSGAADDGDAFVIAKTVAASPLVKTAITGGDPNWGRIVSAAGYAGPKIEPERTSLVIDGVTVFENGTPLSIDAAKLSESMKANSE 376          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_METMA (Arginine biosynthesis bifunctional protein argJ OS=Methanosarcina mazei GN=argJ PE=3 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 9.711e-12
Identity = 38/87 (43.68%), Postives = 46/87 (52.87%), Query Frame = 1
Query:   94 CLDVVMQGL-------AKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKL 333
            CLD   +GL       AK  A DGEGAT LIE RVTGA    +A  +              +G+DPNWGR+ AAAGY+G    Q +L
Sbjct:  239 CLDDFEEGLVCVFTDLAKKMAKDGEGATKLIEARVTGAKKYEDARLVAKTIVRSPLVKSAIFGKDPNWGRVVAAAGYSGAELEQERL 325          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_CHLTE (Arginine biosynthesis bifunctional protein argJ OS=Chlorobium tepidum GN=argJ PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.268e-11
Identity = 43/117 (36.75%), Postives = 54/117 (46.15%), Query Frame = 1
Query:   70 NEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRK 420
            + A+     L  VM  LA+    DGEGAT  +E+RVTGA S  EA                 +G D NWGRI AAAG +G SF Q +L V   D  ++  G    F    A   + K
Sbjct:  252 DNARLFGEALRSVMTMLAQLIIVDGEGATKFVELRVTGAKSNEEARMAAMTVANSPLVKTAIHGEDANWGRIIAAAGRSGASFVQEELSVYFDDEPILKPGLDANFSEERAKEVMSK 368          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_DEIRA (Arginine biosynthesis bifunctional protein argJ OS=Deinococcus radiodurans GN=argJ PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.656e-11
Identity = 41/107 (38.32%), Postives = 55/107 (51.40%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            L+ VM+ LA+  A DGEGAT L+ VRVTGA SEAEA                 +G DPNWGR+  A G +G       ++V +    +  GG PL +D A     ++
Sbjct:  247 LEGVMRDLARQIAADGEGATRLLTVRVTGAASEAEALGAARTCCVSPLLKSAVHGADPNWGRVIMAVGRSGAGVKVEAMKVSVQGVPVFAGG-PLNYDAAAVSQSMK 352          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACHK (Arginine biosynthesis bifunctional protein argJ OS=Bacillus thuringiensis subsp. konkukian GN=argJ PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.826e-11
Identity = 37/97 (38.14%), Postives = 49/97 (50.52%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPF 387
            L  V + LAK  A DGEGAT LIEV V GA +  EA KI              +G DPNWGRI ++ G + V+   N + + L    ++   +P  F
Sbjct:  265 LQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAKKIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVAINPNTIEITLQSIAVLKNSEPQTF 361          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_METAC (Arginine biosynthesis bifunctional protein argJ OS=Methanosarcina acetivorans GN=argJ PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.690e-11
Identity = 35/84 (41.67%), Postives = 45/84 (53.57%), Query Frame = 1
Query:   82 QLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKL 333
            + +  L  +   LAK  A DGEGAT LIE RVTGA +  +A                 +G+DPNWGR+ AAAGY+G    Q +L
Sbjct:  242 EFEDALIYLFTDLAKKMARDGEGATKLIEARVTGAKTYEDARLAVKAIVRSPLVKSAIFGKDPNWGRVVAAAGYSGAELEQERL 325          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_DESVH (Arginine biosynthesis bifunctional protein argJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argJ PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.690e-11
Identity = 46/130 (35.38%), Postives = 58/130 (44.62%), Query Frame = 1
Query:    1 TNDTVIXXXXXXXXXXXXXXVDCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFD 390
            TNDTV               V+  +  +L   L  V+  LA     DGEGAT ++ V+V+GA  +AEA  +              YGRD NWGRI AA G +G SF    + V L    L   GQP   D
Sbjct:  221 TNDTVFGLANGASGVT----VEGEDLAKLGEALTDVLARLAYMLVQDGEGATKVMRVKVSGAVDDAEAEAVARTVGHSQLVKTAMYGRDANWGRIVAAVGRSGASFKAEDVVVTLCGVELFRNGQPTDLD 346          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_DESPS (Arginine biosynthesis bifunctional protein argJ OS=Desulfotalea psychrophila GN=argJ PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.690e-11
Identity = 38/99 (38.38%), Postives = 52/99 (52.53%), Query Frame = 1
Query:   76 AKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGD-SLLMDG 369
            A+  Q  L  V+  LA     DGEGA+ +I +RV GA  +AEA ++              +G D NWGRI AA G AGV F   ++ +  GD +L+ DG
Sbjct:  242 AEDFQGALQYVLMDLALKIVADGEGASKMITIRVCGAREDAEAEQVARTVANSSLVKTAFFGEDANWGRILAAMGRAGVPFDPYQVDISFGDVTLVRDG 340          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_BACCZ (Arginine biosynthesis bifunctional protein argJ OS=Bacillus cereus (strain ZK / E33L) GN=argJ PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.690e-11
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPF 387
            L  V + LAK  A DGEGAT LIEV V GA +  EA KI              +G DPNWGRI ++ G + V+   N + + L   +++   +P  F
Sbjct:  265 LQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAKKIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVAINPNTIDITLQSIVVLKNSEPQMF 361          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_SILPO (Arginine biosynthesis bifunctional protein argJ OS=Silicibacter pomeroyi GN=argJ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.820e-11
Identity = 37/108 (34.26%), Postives = 53/108 (49.07%), Query Frame = 1
Query:   61 VDCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLP 384
            VD     +  A L+ VM  LA+    DGEGAT  +E+RVTGA ++ +A                  G DPNWGR+  A G +G +  ++ L +  GD L+ + G   P
Sbjct:  252 VDAEGNAEFAAALEAVMLDLAQQVVRDGEGATKFVEIRVTGAANDVDAKVHGLAIANSPLVKTAIAGEDPNWGRVVMAIGKSGAAADRDLLSISFGDILVAEKGWVSP 359          
The following BLAST results are available for this feature:
BLAST of CB250300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
ARGJ_RHOBA4.359e-1231.47Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_METMA9.711e-1243.68Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_CHLTE1.268e-1136.75Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_DEIRA1.656e-1138.32Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACHK2.826e-1138.14Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_METAC3.690e-1141.67Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_DESVH3.690e-1135.38Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_DESPS3.690e-1138.38Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_BACCZ3.690e-1138.14Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_SILPO4.820e-1134.26Arginine biosynthesis bifunctional protein argJ OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0079 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ107 similar to putative glutamate/ornithine acetyltransferase (acc# NP_565863), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250300 ID=CB250300|Name=CB250300|organism=Citrus sinensis|type=EST|length=437bp
ACCAATGATACTGTCATAGCTTTGGCTAGTGGGTTATCTAGATCAAGCAG
GTTATCTTCTGTTGACTGTAACGAAGCCAAGCAACTTCAAGCATGCCTTG
ATGTGGTAATGCAAGGTCTTGCCAAGTCTACAGCTTGGGATGGAGAAGGA
GCAACGTGCTTAATTGAGGTCAGAGTGACCGGTGCTAACAGTGAGGCTGA
AGCAGCCAAGATCGCCCGCTCAGTGGCATCTTCTTCACTTGTCAAGGCAG
CTGTATACGGCAGAGATCCGAACTGGGGACGCATTGCTGCAGCTGCTGGA
TATGCAGGGGTTTCTTTCTACCAAAACAAGCTCCGCGTATTGCTTGGAGA
TAGTTTGCTCATGGATGGTGGGCAACCACTCCCATTTGACAGGGCTGTGG
CTGGTAACTATCTCAGGAAGGCTGGTGAGACCCGCGG
back to top