CB250306

Overview
NameCB250306
Unique NameCB250306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length322
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_METPE (Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.287e-12
Identity = 38/101 (37.62%), Postives = 54/101 (53.47%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFE 305
            LNE  + ++ G   A + G LA+E ++ +   + DV LH DAIHRG  QVIP  R  + A  L A   LLEP+  + I  P   +G   S +  +RG V +
Sbjct:  554 LNETMELILEGLHEALQGGPLADEPVQNMKIRLVDVKLHEDAIHRGPAQVIPAVRSAVKAGILYAGDSLLEPIQKISITVPTDQMGNATSQIQGRRGSVLD 654          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PYRHO (Elongation factor 2 OS=Pyrococcus horikoshii GN=fusA PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 2.987e-12
Identity = 34/104 (32.69%), Postives = 54/104 (51.92%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNE+ D ++ GF  A  EG LA E +  +   + D  +H D +HRG  Q+ P  R  I+ + + + P L EP   V I  P + +G +   + Q+RG + +  Q
Sbjct:  554 LNEVMDLLIDGFHQAMDEGPLAREPVMKVIVRLLDAQVHEDNVHRGPAQIYPAIRTAIHCAMMKSNPVLYEPYQKVIINIPYEYMGAVSREITQRRGQLVDMKQ 657          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_HALSA (Elongation factor 2 OS=Halobacterium salinarium GN=fusA PE=3 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 3.902e-12
Identity = 39/104 (37.50%), Postives = 55/104 (52.88%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNE  + VV G   + ++G LA E + G    + D  LH DAIHRG  QVIP  R  ++ + + A  RLLEP+  V I  P + +G     +  +RG V +  Q
Sbjct:  553 LNETMELVVDGLTDSLEDGPLAAEPVEGALIRLHDARLHEDAIHRGPAQVIPATRDAVHRALIDADIRLLEPIQDVRIDVPSEHMGAASGEVQGRRGRVDDMYQ 656          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_HALS3 (Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.902e-12
Identity = 39/104 (37.50%), Postives = 55/104 (52.88%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNE  + VV G   + ++G LA E + G    + D  LH DAIHRG  QVIP  R  ++ + + A  RLLEP+  V I  P + +G     +  +RG V +  Q
Sbjct:  553 LNETMELVVDGLTDSLEDGPLAAEPVEGALIRLHDARLHEDAIHRGPAQVIPATRDAVHRALIDADIRLLEPIQDVRIDVPSEHMGAASGEVQGRRGRVDDMYQ 656          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_NANEQ (Elongation factor 2 OS=Nanoarchaeum equitans GN=fusA PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.529e-11
Identity = 34/101 (33.66%), Postives = 53/101 (52.48%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFE 305
            + E+ D V+  F      G +A E   G+  ++ D  LH DAIHRG GQVIP  R  I  +   A   L EPV ++ +  P   +G + +++N +RG + +
Sbjct:  572 IGEVIDMVMDAFMQVMDHGPIAWEPCIGLIVKLTDAQLHEDAIHRGPGQVIPAVREAIKLAMKDAGLVLYEPVQVILVDVPPDYIGDVTALINSRRGAILD 672          
The following BLAST results are available for this feature:
BLAST of CB250306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EF2_METPE2.287e-1237.62Elongation factor 2 OS=Methanosphaerula palustris ... [more]
EF2_PYRHO2.987e-1232.69Elongation factor 2 OS=Pyrococcus horikoshii GN=fu... [more]
EF2_HALSA3.902e-1237.50Elongation factor 2 OS=Halobacterium salinarium GN... [more]
EF2_HALS33.902e-1237.50Elongation factor 2 OS=Halobacterium salinarum (st... [more]
EF2_NANEQ2.529e-1133.66Elongation factor 2 OS=Nanoarchaeum equitans GN=fu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0090 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ125 similar to elongation factor 2 (acc# BAA77028), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250306 ID=CB250306|Name=CB250306|organism=Citrus sinensis|type=EST|length=322bp
ACTTGAATGAAATTAAGGATTCAGTTGTTGCTGGGTTCCAGTGGGCATCA
AAGGAAGGTGCATTGGCTGAAGAAAACATGAGGGGCATTTGCTTTGAAGT
TTGTGATGTGGTTCTTCATGCCGATGCTATCCACAGAGGTGGTGGCCAGG
TTATTCCAACTGCTAGAAGGGTCATTTATGCATCCCAGCTTACAGCCAAA
CCAAGGCTTCTTGAGCCTGTCTACTTGGTGGAAATCCAAGCTCCTGAACA
GGCACTTGGTGGTATTTACAGTGTTCTTAACCAGAAACGTGGTCACGTTT
TTGAGGAGATGCAGAGACCTGG
back to top