CB290379
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CB290379 vs. ExPASy Swiss-Prot
Match: P21_SOYBN (Protein P21 OS=Glycine max PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 2.077e-12 Identity = 31/60 (51.67%), Postives = 36/60 (60.00%), Query Frame = -3 Query: 663 FRQPQYCCNGAFSTPDTCKPSTYSQIFKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 842 F+ QYCCN +C P+ YS+ FK CP AYSY DD STFTC G DY + FCP Sbjct: 148 FKTDQYCCNSG-----SCGPTDYSRFFKQRCPDAYSYPKDDPPSTFTCNGGTDYRVVFCP 202
BLAST of CB290379 vs. ExPASy Swiss-Prot
Match: IAAT_MAIZE (Alpha-amylase/trypsin inhibitor OS=Zea mays PE=1 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 2.713e-12 Identity = 30/60 (50.00%), Postives = 40/60 (66.67%), Query Frame = -3 Query: 663 FRQPQYCCNGAFSTPDTCKPSTYSQIFKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 842 F++ +YCC G S + C P+ YS+ FK CP AYSY DD +STFTC +G +Y + FCP Sbjct: 149 FKKDEYCCVG--SAANNCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP 206
BLAST of CB290379 vs. ExPASy Swiss-Prot
Match: ZEAM_MAIZE (Zeamatin OS=Zea mays GN=Zlp PE=1 SV=2) HSP 1 Score: 72.4034 bits (176), Expect = 3.543e-12 Identity = 30/60 (50.00%), Postives = 40/60 (66.67%), Query Frame = -3 Query: 663 FRQPQYCCNGAFSTPDTCKPSTYSQIFKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 842 F++ +YCC G S + C P+ YS+ FK CP AYSY DD +STFTC +G +Y + FCP Sbjct: 170 FKKDEYCCVG--SAANDCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP 227
BLAST of CB290379 vs. ExPASy Swiss-Prot
Match: TLPH_ORYSJ (Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os11g0706600 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.759e-11 Identity = 28/56 (50.00%), Postives = 38/56 (67.86%), Query Frame = -3 Query: 663 QYCCNGAFSTPDTCKPSTYSQIFKSACPHAYSYAYDDKSSTFTCGSGPDYTITFCP 830 +YCC G +++P C+P+ +S +FK+ CP AYSYAYDD +S C Y ITFCP Sbjct: 195 RYCCTGDYASPSACRPTIFSHLFKAICPRAYSYAYDDATSLNRC-HAKRYLITFCP 249 The following BLAST results are available for this feature:
BLAST of CB290379 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB290379 ID=CB290379; Name=CB290379; organism=Citrus sinensis; type=EST; length=844bpback to top |