CB304523
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM4_MOUSE (Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2) HSP 1 Score: 67.0106 bits (162), Expect = 8.493e-11 Identity = 29/61 (47.54%), Postives = 46/61 (75.41%), Query Frame = -1 Query: 404 ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKV 586 EL+ F V D++ +G+I+ EL+ ++ LGE L+ EE+++MIR ADVD DG++ YEEFV++ Sbjct: 84 ELRAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVADVDQDGKVKYEEFVRL 144
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALL4_HUMAN (Calmodulin-like protein 4 OS=Homo sapiens GN=CALML4 PE=2 SV=3) HSP 1 Score: 67.0106 bits (162), Expect = 8.493e-11 Identity = 27/63 (42.86%), Postives = 49/63 (77.78%), Query Frame = -1 Query: 410 DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFV 598 D ++E+ A + DK++ G++ A++LR +T+LGEKLT +EVD++ READ++ +G++ Y+EF+ Sbjct: 124 DPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKVKYDEFI 186 The following BLAST results are available for this feature:
BLAST of CB304523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 272
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304523 ID=CB304523; Name=CB304523; organism=Citrus sinensis; type=EST; length=613bpback to top |