CB304771
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_AZOSB (ATP-dependent Clp protease proteolytic subunit OS=Azoarcus sp. (strain BH72) GN=clpP PE=3 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 2.494e-12 Identity = 35/71 (49.30%), Postives = 49/71 (69.01%), Query Frame = -3 Query: 471 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 683 +MI QP+G +GQA+D+EI +EI ++ L + AKH G+T EQIE D R + S + AVEYG++DKVL Sbjct: 136 VMIHQPLGGFQGQASDIEIHAREILYLRERLNGMLAKHTGQTIEQIEKDTDRDNFMSATAAVEYGLVDKVL 206
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_WIGBR (ATP-dependent Clp protease proteolytic subunit OS=Wigglesworthia glossinidia brevipalpis GN=clpP PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.258e-12 Identity = 36/75 (48.00%), Postives = 50/75 (66.67%), Query Frame = -3 Query: 459 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEK 683 IMI QP+G +GQATD+ I EI +K +++L +KH G++ E I D R ++FS SEAV YG+IDKV+ K Sbjct: 120 IMIHQPLGGSQGQATDIAIHTTEILKIKKCMIELLSKHTGQSAEIISKDTERDRFFSGSEAVIYGLIDKVITCRK 194
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_DESMR (ATP-dependent Clp protease proteolytic subunit OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=clpP PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.258e-12 Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = -3 Query: 450 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPE 683 IMI QP G +GQATD+EI KE + + L ++ AKH G++ E+I+ D R + S EAV YG+IDKVL + + E Sbjct: 120 IMIHQPSGGYQGQATDIEIHAKETRRTRETLNEIMAKHTGQSMERIQVDTERDNFMSAEEAVAYGLIDKVLTSRERLE 197
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_ALCBS (ATP-dependent Clp protease proteolytic subunit OS=Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) GN=clpP PE=3 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 3.258e-12 Identity = 36/71 (50.70%), Postives = 46/71 (64.79%), Query Frame = -3 Query: 471 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVL 683 +MI QP+G +GQA+D+EI KEI +K +L L A H G+ EQ+E D R + S EA EYGIID VL Sbjct: 130 VMIHQPLGGFQGQASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDTDRDNFMSADEAKEYGIIDAVL 200
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_MAGSM (ATP-dependent Clp protease proteolytic subunit OS=Magnetococcus sp. (strain MC-1) GN=clpP PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 4.255e-12 Identity = 33/78 (42.31%), Postives = 50/78 (64.10%), Query Frame = -3 Query: 450 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKVLYTEKSPE 683 +MI QP+G GQA+D EI +EI ++ L ++ + H GK EQ++ D R + S +EAVEYG++DKV+ + PE Sbjct: 120 VMIHQPLGGFSGQASDFEIHAREILRIRENLNQVLSHHTGKPLEQVQLDTERDNFLSATEAVEYGLVDKVISHRELPE 197
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP2_MYXXA (ATP-dependent Clp protease proteolytic subunit 2 OS=Myxococcus xanthus GN=clpP2 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 4.255e-12 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = -3 Query: 474 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 IMI QP+G + GQATD+EI KEI +KA+L +L KH G++ E++E D R + SEA YGIID++ Sbjct: 122 IMIHQPLGGVRGQATDIEIQAKEILRMKAKLNELIVKHTGQSIERVEKDTDRDYFMGASEAKAYGIIDEI 191
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP1_MYXXD (ATP-dependent Clp protease proteolytic subunit 1 OS=Myxococcus xanthus (strain DK 1622) GN=clpP1 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 4.255e-12 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = -3 Query: 474 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 IMI QP+G + GQATD+EI KEI +KA+L +L KH G++ E++E D R + SEA YGIID++ Sbjct: 122 IMIHQPLGGVRGQATDIEIQAKEILRMKAKLNELIVKHTGQSIERVEKDTDRDYFMGASEAKAYGIIDEI 191
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_PSEPW (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain W619) GN=clpP PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-12 Identity = 35/70 (50.00%), Postives = 46/70 (65.71%), Query Frame = -3 Query: 474 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 +MI QP+G +GQATD+EI +EI N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_PSEPK (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain KT2440) GN=clpP PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-12 Identity = 35/70 (50.00%), Postives = 46/70 (65.71%), Query Frame = -3 Query: 474 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 +MI QP+G +GQATD+EI +EI N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205
BLAST of CB304771 vs. ExPASy Swiss-Prot
Match: CLPP_PSEP1 (ATP-dependent Clp protease proteolytic subunit OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpP PE=3 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-12 Identity = 35/70 (50.00%), Postives = 46/70 (65.71%), Query Frame = -3 Query: 474 IMIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIIDKV 683 +MI QP+G +GQATD+EI +EI N+KA L +L A H G+ E I+ D R + S S A EYG+ID V Sbjct: 136 VMIHQPLGGFQGQATDIEIHAQEILNIKARLNELLAYHTGQDLETIKRDTERDNFMSASRAAEYGLIDSV 205 The following BLAST results are available for this feature:
BLAST of CB304771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 129
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304771 ID=CB304771; Name=CB304771; organism=Citrus sinensis; type=EST; length=685bpback to top |