CB304793

Overview
NameCB304793
Unique NameCB304793
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_ECOL5 (Chaperone protein dnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_ECOK1 (Chaperone protein dnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_ECOHS (Chaperone protein dnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_ECO57 (Chaperone protein dnaK OS=Escherichia coli O157:H7 GN=dnaK PE=2 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_ECO24 (Chaperone protein dnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_CORJK (Chaperone protein dnaK OS=Corynebacterium jeikeium (strain K411) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 103/186 (55.38%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+  V +L+ +  NGKE  K  NPDE           +L GE    V+D+LLLDVTP SLG+ET GGVMT LI RNTTIP K+ + F+T  D+QP V IQV++GER     N LLG FEL+GI PAPRGVPQI V FDIDANGI++VSA+DK  G++N I I +  G LS++EI++MV++AE
Sbjct:  314 GGSTRMVAVSELVTELTNGKEPNKGVNPDEVVAVGAALQAGVLRGE----VKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETFTTAEDSQPSVQIQVFQGEREMAAHNKLLGSFELAGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKATGKENTIKIQDGSG-LSQEEIDRMVKDAE 494          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_COREF (Chaperone protein dnaK OS=Corynebacterium efficiens GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 102/186 (54.84%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P V  L+++   G+E  K  NPDE           +L GE    V+D+LLLDVTP SLG+ET GGVMT LI RNTTIP K+ + F+T  DNQP V IQV++GER     N LLG FEL GI PAPRGVPQI V FDIDANGI++V+A+DK  G++N ITI +  G LS++EI++M+++AE
Sbjct:  314 GGSTRMPAVTDLVKELTGGREPNKGVNPDEVVAVGAALQAGVLRGE----VKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETFTTAEDNQPSVQIQVFQGEREIASANKLLGSFELGGIAPAPRGVPQIEVTFDIDANGIVHVTAKDKGTGKENTITIQDGSG-LSQEEIDRMIKDAE 494          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_CORA7 (Chaperone protein dnaK OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 105/186 (56.45%), Postives = 129/186 (69.35%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P V  L+++   GK+  K  NPDE           +L GE    V+D+LLLDVTP SLG+ET GGVMT LI RNTTIP KK + F+T  DNQP V IQVY+GER     N LLG FEL GI PAPRGVPQI V FDIDANGI++VSA+DK  G++N I I +  G LS++EI++MV++AE
Sbjct:  314 GGSTRMPAVSDLVKEM-TGKDPNKGVNPDEVVAVGAALQAGVLRGE----VKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKKSETFTTADDNQPSVQIQVYQGEREMASANKLLGSFELGGIAPAPRGVPQIEVTFDIDANGIVSVSAKDKATGKENTIKIQDGSG-LSQEEIDRMVKDAE 493          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_CITK8 (Chaperone protein dnaK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 106/186 (56.99%), Postives = 130/186 (69.89%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P VQ+ + +FF GKE  K  NPDE           +L+G+    V+D+LLLDVTP SLG+ET GGVMT LI +NTTIP K  QVFST  DNQ  V I V +GER R  DN  LG+F L GI PAPRG+PQI V FDIDA+GIL+VSA+DK  G++ KITI    G L++DEI+KMV++AE
Sbjct:  341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSG-LNEDEIQKMVRDAE 520          
BLAST of CB304793 vs. ExPASy Swiss-Prot
Match: DNAK_BIFA0 (Chaperone protein dnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.738e-48
Identity = 99/186 (53.23%), Postives = 131/186 (70.43%), Query Frame = -1
Query:   28 GGFTRIPKVQQLLQDFFNGKELCKSTNPDEXXXXXXXXXXAILSGEGNEKVQDLLLLDVTPFSLGLETAGGVMTVLIPRNTTIPPKKEQVFSTYFDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTPGQKNKITIANDKGRLSKDEIEKMVQEAE 585
            GG TR+P V++L+++   GKE  +S NPDE           ++ G+     +D+LL+DVTP SLG+ET GG+MT LI RNT IP K+ ++FST  DNQP VLIQVY+GER   RDN  LG FEL+GI PAPRGVPQI V FDIDANGI++VSA+DK  G++  +TI      L K+EI++M+++AE
Sbjct:  319 GGSTRMPAVKELVKELDGGKEANQSVNPDEVVAIGAAVQSGVIKGDR----KDVLLIDVTPLSLGIETKGGIMTKLIERNTAIPAKRSEIFSTAEDNQPSVLIQVYQGEREFARDNKPLGTFELTGIAPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSA-LPKEEIDQMIKDAE 499          
The following BLAST results are available for this feature:
BLAST of CB304793 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_ECOL52.738e-4856.99Chaperone protein dnaK OS=Escherichia coli O6:K15:... [more]
DNAK_ECOK12.738e-4856.99Chaperone protein dnaK OS=Escherichia coli O1:K1 /... [more]
DNAK_ECOHS2.738e-4856.99Chaperone protein dnaK OS=Escherichia coli O9:H4 (... [more]
DNAK_ECO572.738e-4856.99Chaperone protein dnaK OS=Escherichia coli O157:H7... [more]
DNAK_ECO242.738e-4856.99Chaperone protein dnaK OS=Escherichia coli O139:H2... [more]
DNAK_CORJK2.738e-4855.38Chaperone protein dnaK OS=Corynebacterium jeikeium... [more]
DNAK_COREF2.738e-4854.84Chaperone protein dnaK OS=Corynebacterium efficien... [more]
DNAK_CORA72.738e-4856.45Chaperone protein dnaK OS=Corynebacterium aurimuco... [more]
DNAK_CITK82.738e-4856.99Chaperone protein dnaK OS=Citrobacter koseri (stra... [more]
DNAK_BIFA02.738e-4853.23Chaperone protein dnaK OS=Bifidobacterium animalis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_A03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_A03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304793 ID=CB304793; Name=CB304793; organism=Citrus sinensis; type=EST; length=585bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCGCCTCTTGAACCATCTTCT
CAATTTCATCCTTTGAAAGTCTTCCTTTGTCATTAGCGATGGTGATCTTG
TTCTTTTGACCAGGGGTCTTGTCCTCGGCAGACACATTCAGGATACCATT
GGCATCGATGTCGAAGCACACAGTGATTTGAGGAACACCCCTAGGAGCTG
GGGGAATACCAGAGAGCTCGAATTTACCCAACAAGTTATTGTCCCTGGTT
CTTGTCCTTTCACCTTCATAAACTTGGATCAACACACCAGGTTGGTTGTC
AAAGTAAGTTGAAAAAACCTGCTCCTTCTTGGGGGGAATGGTCGTGTTCC
TTGGAATCAACACAGTCATGACACCACCAGCAGTCTCCAAACCAAGGGAG
AAAGGCGTGACATCCAATAGCAAAAGATCCTGCACCTTCTCATTACCCTC
ACCACTCAAGATAGCAGCTTGCACAGCAGCACCATAGGCAACAGCCTCAT
CGGGGTTGGTGCTCTTGCAAAGCTCCTTCCCATTAAAGAAATCTTGCAAA
AGCTGCTGGACTTTGGGAATCCTAGTAAATCCTCC
back to top