CB305151
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB305151 vs. ExPASy Swiss-Prot
Match: TM167_DICDI (Transmembrane protein 167 homolog OS=Dictyostelium discoideum GN=tmem167 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.629e-13 Identity = 39/71 (54.93%), Postives = 48/71 (67.61%), Query Frame = -2 Query: 194 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILEHRT--GFRGFFWKAARIGERLSPWVAVGCFSMGLSIIF 400 M A+FNF S L V+LL ICTCTYI+ +P++LE R F G KAA IGERLSPWV+ C MGL ++ Sbjct: 1 MVAIFNFQSLLVVILLFICTCTYIRGSYPSLLEVRDKHSFSGLPRKAAIIGERLSPWVSACCLIMGLWTLY 71
BLAST of CB305151 vs. ExPASy Swiss-Prot
Match: TM167_YEAST (Transmembrane protein 167 homolog OS=Saccharomyces cerevisiae GN=YNL024C-A PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.056e-12 Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = -2 Query: 203 MSALFNFHSFLTVVLLGICTCTYIKMQFPAILEHRTGFR--GFFWKAARIGERLSPWVAVGCFSMGLS 400 MSALFNF S L V+LL IC+C+Y+ Q+P++L+ G FWK AR+GER SP+V++ C M +S Sbjct: 1 MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSLACILMAIS 68 The following BLAST results are available for this feature:
BLAST of CB305151 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB305151 ID=CB305151; Name=CB305151; organism=Citrus sinensis; type=EST; length=515bpback to top |