CB322194
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_BRASO (Thiamine biosynthesis protein thiC OS=Bradyrhizobium sp. (strain ORS278) GN=thiC PE=3 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 9.617e-19 Identity = 44/58 (75.86%), Postives = 49/58 (84.48%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 184 FVRDEIARGRAIIPCNINHAELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 241
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_ACIAD (Thiamine biosynthesis protein thiC OS=Acinetobacter sp. (strain ADP1) GN=thiC PE=3 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 9.617e-19 Identity = 44/59 (74.58%), Postives = 51/59 (86.44%), Query Frame = -3 Query: 4 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWAT 180 FVR EVA GRAIIP+N H E+EPMI+GRNFLVK+NANIGNSA+ SSI+EEV K+ WAT Sbjct: 194 FVRQEVAAGRAIIPANINHPEIEPMIIGRNFLVKINANIGNSALGSSIDEEVSKMTWAT 252
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_YERPS (Thiamine biosynthesis protein thiC OS=Yersinia pseudotuberculosis GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 46/59 (77.97%), Postives = 50/59 (84.75%), Query Frame = -3 Query: 4 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWAT 180 FVR EVA GRAIIP+N H E EPMI+GRNFLVKVNANIGNSAV SSIEEEV K+ W+T Sbjct: 217 FVRQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWST 275
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_YERPE (Thiamine biosynthesis protein thiC OS=Yersinia pestis GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 46/59 (77.97%), Postives = 50/59 (84.75%), Query Frame = -3 Query: 4 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWAT 180 FVR EVA GRAIIP+N H E EPMI+GRNFLVKVNANIGNSAV SSIEEEV K+ W+T Sbjct: 217 FVRQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWST 275
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_RHOPT (Thiamine biosynthesis protein thiC OS=Rhodopseudomonas palustris (strain TIE-1) GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 184 FVRDEIARGRAIIPANINHGELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 241
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_RHOPS (Thiamine biosynthesis protein thiC OS=Rhodopseudomonas palustris (strain BisB5) GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 184 FVRDEIARGRAIIPANINHGELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 241
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_RHOPA (Thiamine biosynthesis protein thiC OS=Rhodopseudomonas palustris GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 209 FVRDEIARGRAIIPANINHGELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 266
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_RHOP5 (Thiamine biosynthesis protein thiC OS=Rhodopseudomonas palustris (strain BisA53) GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 184 FVRDEIARGRAIIPANINHGELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 241
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_RHOP2 (Thiamine biosynthesis protein thiC OS=Rhodopseudomonas palustris (strain HaA2) GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = -3 Query: 7 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWA 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFL K+NANIGNSAV SS+EEEV K+ WA Sbjct: 184 FVRDEIARGRAIIPANINHGELEPMIIGRNFLTKINANIGNSAVTSSVEEEVDKMVWA 241
BLAST of CB322194 vs. ExPASy Swiss-Prot
Match: THIC_PSEPW (Thiamine biosynthesis protein thiC OS=Pseudomonas putida (strain W619) GN=thiC PE=3 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 43/57 (75.44%), Postives = 49/57 (85.96%), Query Frame = -3 Query: 10 FVRAEVARGRAIIPSNKKHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQW 180 FVR E+ARGRAIIP+N H ELEPMI+GRNFLVK+N NIGNSA+ SSIEEEV K+ W Sbjct: 195 FVREEIARGRAIIPANINHTELEPMIIGRNFLVKINGNIGNSALGSSIEEEVAKLTW 251 The following BLAST results are available for this feature:
BLAST of CB322194 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 303
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB322194 ID=CB322194; Name=CB322194; organism=Citrus sinensis; type=EST; length=182bpback to top |