CB610479
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610479 vs. ExPASy Swiss-Prot
Match: CIPKB_ORYSJ (CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.644e-11 Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 2 Query: 17 KKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYK-NLSTGLKDVVWK-SGDE 223 KK+N L+L K G+KG L + EIFEV PS +VEL+K+ GDT+E+ K K ++ LKD+VW GDE Sbjct: 369 KKDNGVLRLAAPKEGKKGFLELDAEIFEVTPSFLLVELKKTNGDTMEYRKLVKEDIRPALKDIVWVWQGDE 439
BLAST of CB610479 vs. ExPASy Swiss-Prot
Match: CIPK5_ARATH (CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.677e-11 Identity = 30/65 (46.15%), Postives = 45/65 (69.23%), Query Frame = 2 Query: 17 KKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFY-KNLSTGLKDVVW 208 + +FK+K++G+ GRKG LS+ E+FEVAP + +VE KS GDTLE+ + Y + + L D+VW Sbjct: 367 RTKDFKVKMEGKTEGRKGRLSMTAEVFEVAPEISVVEFCKSAGDTLEYDRLYEEEVRPALNDIVW 431
BLAST of CB610479 vs. ExPASy Swiss-Prot
Match: CIPK2_ORYSJ (CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.677e-11 Identity = 31/65 (47.69%), Postives = 45/65 (69.23%), Query Frame = 2 Query: 17 KKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHK-FYKNLSTGLKDVVW 208 KK+ LK++G K GRKG + + EIFEV P+ ++VEL+K+ GDTLE+ K + + LKD+VW Sbjct: 364 KKDGGLLKMEGSKPGRKGVMGIDAEIFEVTPNFHLVELKKTNGDTLEYRKVLNQEMRPALKDIVW 428 The following BLAST results are available for this feature:
BLAST of CB610479 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610479 ID=CB610479; Name=CB610479; organism=Citrus sinensis; type=EST; length=621bpback to top |