CB610616
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610616 vs. ExPASy Swiss-Prot
Match: RL3_CALMQ (50S ribosomal protein L3P OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=rpl3p PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 4.019e-11 Identity = 43/109 (39.45%), Postives = 55/109 (50.46%), Query Frame = 1 Query: 1 GVTRLPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGSPHYGVVNEDYLLIKGCCVGPKKRVVTLR 321 GV LPR K +G R+ +G PA V +T R GQ G+H RTE NK+I K+ E ITP GG HYG+V Y+LI+G G KR++ R Sbjct: 224 GVKELPRWHKHRKGSRRTGTVGP-KPA-VMYTQPRMGQMGFHRRTEYNKRILKISDNGSE--------------ITPKGGFKHYGIVRSGYMLIEGSTPGVVKRLIAFR 316
BLAST of CB610616 vs. ExPASy Swiss-Prot
Match: RL3_HALWD (50S ribosomal protein L3P OS=Haloquadratum walsbyi (strain DSM 16790) GN=rpl3p PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.856e-11 Identity = 38/121 (31.40%), Postives = 64/121 (52.89%), Query Frame = 1 Query: 40 RKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGSPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFG 402 R++ +G W+P+RV TV + GQ GYH RTE+NK++ ++G + T GG YG V+ Y LIKG GP +R++ R ++ + S + +++++ T+S G Sbjct: 235 RRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIEIGNGDEP---------------TVDGGFVGYGEVDGPYALIKGSLPGPDQRLLRFRTAV--RPSDQPRLDPEVRYVSTASNQG 338 The following BLAST results are available for this feature:
BLAST of CB610616 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610616 ID=CB610616; Name=CB610616; organism=Citrus sinensis; type=EST; length=628bpback to top |