CB610635
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610635 vs. ExPASy Swiss-Prot
Match: ACON_STAAR (Aconitate hydratase OS=Staphylococcus aureus (strain MRSA252) GN=acnA PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.234e-12 Identity = 34/54 (62.96%), Postives = 39/54 (72.22%), Query Frame = 2 Query: 5 DIXAVAVLSGNRNFGSXPFPLTRANYLADRSLVVAYALAGTVDIDFEKEPIGTG 166 D+ +VLSGNRNF PL +ANYLA LVVAYALAG+VDID + EPIG G Sbjct: 531 DLLVTSVLSGNRNFEGRIHPLVKANYLASPQLVVAYALAGSVDIDLQNEPIGKG 584
BLAST of CB610635 vs. ExPASy Swiss-Prot
Match: ACOC_DICDI (Probable cytoplasmic aconitate hydratase OS=Dictyostelium discoideum GN=aco1 PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.234e-12 Identity = 35/55 (63.64%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 5 DIXAVAVLSGNRNFGSXPFPLTRANYLADRSLVVAYALAGTVDIDFEKEPIGTGE 169 D+ VLSGNRNF PL RANYLA LVVAYALAGTVDIDFE P+G + Sbjct: 526 DLVVAGVLSGNRNFEGRIHPLLRANYLASPPLVVAYALAGTVDIDFETTPLGVSK 580
BLAST of CB610635 vs. ExPASy Swiss-Prot
Match: IREB2_CHICK (Iron-responsive element-binding protein 2 OS=Gallus gallus GN=IREB2 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.989e-11 Identity = 35/55 (63.64%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 2 GDIXAVAVLSGNRNFGSXPFPLTRANYLADRSLVVAYALAGTVDIDFEKEPIGTG 166 GDI A VLSG +NF RANYLA LVVAYA+AGTV IDFE EP+GTG Sbjct: 601 GDIIACGVLSGTKNFEGRLCDCVRANYLASPPLVVAYAIAGTVRIDFETEPLGTG 655
BLAST of CB610635 vs. ExPASy Swiss-Prot
Match: IREB2_RAT (Iron-responsive element-binding protein 2 OS=Rattus norvegicus GN=Ireb2 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.871e-11 Identity = 32/54 (59.26%), Postives = 38/54 (70.37%), Query Frame = 2 Query: 2 GDIXAVAVLSGNRNFGSXPFPLTRANYLADRSLVVAYALAGTVDIDFEKEPIGT 163 GD+ VLSGN+NF RANYLA LVVAYA+AGTV+IDF+ EP+GT Sbjct: 599 GDLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGT 652 The following BLAST results are available for this feature:
BLAST of CB610635 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 24
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610635 ID=CB610635; Name=CB610635; organism=Citrus sinensis; type=EST; length=196bpback to top |