CB610765
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610765 vs. ExPASy Swiss-Prot
Match: RS28_CANGA (40S ribosomal protein S28 OS=Candida glabrata GN=RPS28A PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.353e-12 Identity = 35/48 (72.92%), Postives = 42/48 (87.50%), Query Frame = 1 Query: 100 AVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDILTLV 243 A V+KV+GRTGSRG VTQVRV+FL+D +R I+RNVKGPVRE DIL L+ Sbjct: 10 ARVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLM 57
BLAST of CB610765 vs. ExPASy Swiss-Prot
Match: RS28_SPOFR (40S ribosomal protein S28 OS=Spodoptera frugiperda GN=RpS28 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 6.845e-12 Identity = 35/55 (63.64%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 79 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDILTLV 243 MD A VVKV+GRTGS+GQ TQV+V+F+ + +R I+RNVKGPVR+GDILTL+ Sbjct: 1 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILTLL 55
BLAST of CB610765 vs. ExPASy Swiss-Prot
Match: RS28_PAPDA (40S ribosomal protein S28 OS=Papilio dardanus GN=RpS28 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 6.845e-12 Identity = 35/55 (63.64%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 79 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDILTLV 243 MD A VVKV+GRTGS+GQ TQV+V+F+ + +R I+RNVKGPVR+GDILTL+ Sbjct: 1 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILTLL 55
BLAST of CB610765 vs. ExPASy Swiss-Prot
Match: RS28_BOMMO (40S ribosomal protein S28 OS=Bombyx mori GN=RpS28 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 6.845e-12 Identity = 35/55 (63.64%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 79 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDILTLV 243 MD A VVKV+GRTGS+GQ TQV+V+F+ + +R I+RNVKGPVR+GDILTL+ Sbjct: 1 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILTLL 55 The following BLAST results are available for this feature:
BLAST of CB610765 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 24
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610765 ID=CB610765; Name=CB610765; organism=Citrus sinensis; type=EST; length=513bpback to top |