CF417071

Overview
NameCF417071
Unique NameCF417071
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF417071_ssr538 microsatellite CF417071_ssr538:538..553. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10454 contig Csv1_Contig10454:381..1040. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA8_ORYSJ (Expansin-A8 OS=Oryza sativa subsp. japonica GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.893e-54
Identity = 99/144 (68.75%), Postives = 114/144 (79.17%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTY-SGAQF 430
            N AL  +AGGWCNPP++HFD+SQP ++ IA YRAG+VPV YRRVPC R GGIRF +NGHSYF LVL+TNVGG+G V  + IKGS TGW  MSRNWG NWQSN  L+GQ+LSF V   DGR VT+ +VAPAGWSFG TY S AQF
Sbjct:  107 NYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRFAVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSFRVQADDGRVVTAADVAPAGWSFGATYTSSAQF 250          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA6_ARATH (Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 1.893e-54
Identity = 93/144 (64.58%), Postives = 116/144 (80.56%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQFR 433
            N A P++ GGWCNPP+ HFDL+ P+F  IA+YRAG+VPV++RRVPC +RGGIRFTING  YFNLVL+TNV GAG++  + +KG+ T W  MSRNWGQNWQSN+ L GQSLSF VT+SD R+ TS+N+APA W FG+T+ G  FR
Sbjct:  113 NFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGNIVRLGVKGTHTSWMTMSRNWGQNWQSNSVLVGQSLSFRVTSSDRRSSTSWNIAPANWKFGQTFMGKNFR 256          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA3_ORYSJ (Expansin-A3 OS=Oryza sativa subsp. japonica GN=EXPA3 PE=2 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 2.473e-54
Identity = 95/139 (68.35%), Postives = 112/139 (80.58%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYS 418
            N ALP+N+GGWCNPP+QHFD+SQP +++IA Y+AG+VPV Y+RVPC R GGIRF I+GH YF LV +TNVGG+G V  +SIKGS TGW  MSRNWG NWQSN YL GQSLSF V   DGR VT++NVAP+ W FG TYS
Sbjct:  111 NWALPSNSGGWCNPPRQHFDMSQPAWENIAVYQAGIVPVNYKRVPCQRSGGIRFAISGHDYFELVTVTNVGGSGVVAQMSIKGSNTGWMAMSRNWGANWQSNAYLAGQSLSFIVQLDDGRKVTAWNVAPSNWFFGATYS 249          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP11_ARATH (Expansin-A11 OS=Arabidopsis thaliana GN=EXPA11 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.270e-50
Identity = 87/139 (62.59%), Postives = 107/139 (76.98%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYS 418
            N ALPNN GGWCNPP +HFD++QP ++ I  YR G+VPV ++RV C ++GG+RF ING  YF LV I NVGGAG + +VSIKGS+TGW  MSRNWG NWQSN YL+GQ+LSF +TT+DG T    NV P+ WSFG+ YS
Sbjct:  109 NFALPNNNGGWCNPPLKHFDMAQPAWEKIGIYRGGIVPVVFQRVSCYKKGGVRFRINGRDYFELVNIQNVGGAGSIKSVSIKGSKTGWLAMSRNWGANWQSNAYLDGQALSFSITTTDGATRVFLNVVPSSWSFGQIYS 247          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP12_ORYSJ (Expansin-A12 OS=Oryza sativa subsp. japonica GN=EXPA12 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.166e-50
Identity = 85/140 (60.71%), Postives = 112/140 (80.00%), Query Frame = 2
Query:   14 PNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTY-SGAQF 430
            P+N GGWCNPP+QHFD++QP ++ I  YR G+VPV ++RV C R+GG+RFTING+SYF LVLITNVGG G + +V IKG++TGW  MSRNWG NWQ+N YLN Q++SF VT++ G+T+   +VAP+ W FG+T+ SG QF
Sbjct:  110 PSNDGGWCNPPRQHFDMAQPAWEQIGVYRGGIVPVNFQRVSCTRKGGVRFTINGNSYFELVLITNVGGPGSIKSVQIKGTKTGWVTMSRNWGANWQANNYLNNQAISFSVTSTAGKTLVFEDVAPSNWQFGQTFTSGVQF 249          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP33_ORYSJ (Expansin-A33 OS=Oryza sativa subsp. japonica GN=EXPA33 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.395e-49
Identity = 87/139 (62.59%), Postives = 108/139 (77.70%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYS 418
            N A  ++AGGWCNPP++HFD+SQP +  IA Y+AG+VPV ++RVPC + GGIRFTI+G  YF LV + NVGG+G V  VSIKGS+T W  MSRNWGQNWQSN YLN QSLSF+V   D R VT +N+AP+ W+FG TY+
Sbjct:  105 NYAKKSDAGGWCNPPRKHFDMSQPAWTSIAIYQAGIVPVNFKRVPCQKSGGIRFTISGRDYFELVTVFNVGGSGVVAQVSIKGSKTDWMAMSRNWGQNWQSNAYLNTQSLSFKVKLDDAREVTVWNIAPSNWNFGTTYT 243          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP29_ORYSJ (Expansin-A29 OS=Oryza sativa subsp. japonica GN=EXPA29 PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 7.704e-48
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSR--TGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYSGAQ 427
            N ALP++ GGWCNPP+ HFD++QP ++ I  YR G+VPVA+RRVPC RRGG+RFT+ G  YF LVL+TNV  AG V ++ ++GSR   GW  MSRNWG NWQS  YL+GQ LSF VT +DG+T+    V P  W FG+T++  Q
Sbjct:  117 NYALPSDDGGWCNPPRPHFDMAQPAWERIGVYRGGIVPVAFRRVPCRRRGGVRFTVAGRDYFELVLVTNVAAAGSVRSMEVRGSRRGAGWMAMSRNWGANWQSLAYLDGQGLSFRVTATDGQTIVFAGVVPPSWRFGQTFASTQ 260          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP27_ORYSJ (Putative expansin-A27 OS=Oryza sativa subsp. japonica GN=EXPA27 PE=3 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 1.716e-47
Identity = 84/139 (60.43%), Postives = 106/139 (76.26%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTYS 418
            N ALP++ GGWCNPP++HFD+SQP ++ I  YRAG+VPV YRRV C RRGG+RFT+ G  +F LVL+ NV G+G V AVS++G+ TGW  MSRNWG NWQS   L GQ LSF VTT+ G+ +   +VAPAGW FG+T+S
Sbjct:  110 NWALPSDGGGWCNPPRRHFDMSQPAWERIGVYRAGIVPVLYRRVRCWRRGGVRFTVGGFDHFELVLVANVAGSGSVAAVSVRGAGTGWLQMSRNWGANWQSLAGLAGQPLSFGVTTTGGQYILFQDVAPAGWKFGQTFS 248          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXPA9_ORYSJ (Expansin-A9 OS=Oryza sativa subsp. japonica GN=EXPA9 PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 3.823e-47
Identity = 84/138 (60.87%), Postives = 101/138 (73.19%), Query Frame = 2
Query:    2 NNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTY 415
            N +   +AGGWCNPP++HFD+SQP ++ IA Y +G+VPV Y R PC R GGIRF I GH Y+ LVL+TNV G+G V A  +KGS T W  MSRNWG+NWQSN YL GQ+LSF V   DG  VT+Y+VAPA W FG TY
Sbjct:  109 NYSESGDAGGWCNPPRRHFDMSQPAWEAIAVYSSGIVPVRYARTPCRRVGGIRFGIAGHDYYELVLVTNVAGSGAVAAAWVKGSGTEWLSMSRNWGENWQSNAYLTGQALSFRVQADDGGVVTAYDVAPANWQFGSTY 246          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXP24_ORYSJ (Expansin-A24 OS=Oryza sativa subsp. japonica GN=EXPA24 PE=2 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 1.112e-46
Identity = 81/143 (56.64%), Postives = 106/143 (74.13%), Query Frame = 2
Query:   11 LPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGVVPVAYRRVPCGRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSR-TGWQPMSRNWGQNWQSNTYLNGQSLSFEVTTSDGRTVTSYNVAPAGWSFGRTY-SGAQFR 433
            LP++ GGWCNPP+ HFD++QP ++ I  YRAG++PV Y+RVPC ++GG+RFTINGH YFNLVL+TNV   G + ++ I GS  T W PM RNWG NW S +YL GQ LSF VT  DG+T+   N+ P+GW FG+T+ S  QF+
Sbjct:  136 LPSDNGGWCNPPRPHFDMAQPAWEKIGIYRAGIIPVMYQRVPCVKKGGVRFTINGHDYFNLVLVTNVATTGSIKSMDIMGSNSTDWMPMVRNWGANWHSLSYLTGQMLSFRVTNMDGQTLVFRNIVPSGWKFGQTFASKLQFK 278          
The following BLAST results are available for this feature:
BLAST of CF417071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
EXPA8_ORYSJ1.893e-5468.75Expansin-A8 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA6_ARATH1.893e-5464.58Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 ... [more]
EXPA3_ORYSJ2.473e-5468.35Expansin-A3 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP11_ARATH1.270e-5062.59Expansin-A11 OS=Arabidopsis thaliana GN=EXPA11 PE=... [more]
EXP12_ORYSJ2.166e-5060.71Expansin-A12 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXP33_ORYSJ2.395e-4962.59Expansin-A33 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXP29_ORYSJ7.704e-4856.94Expansin-A29 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXP27_ORYSJ1.716e-4760.43Putative expansin-A27 OS=Oryza sativa subsp. japon... [more]
EXPA9_ORYSJ3.823e-4760.87Expansin-A9 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP24_ORYSJ1.112e-4656.64Expansin-A24 OS=Oryza sativa subsp. japonica GN=EX... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-001 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_A1 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417071 ID=CF417071|Name=CF417071|organism=Citrus sinensis|type=EST|length=662bp
GAACAACGCCCTTCCCAACAATGCAGGCGGTTGGTGCAATCCTCCGCAGC
AACATTTTGATCTCTCTCAGCCTGTGTTCCAACACATTGCTCAATACAGA
GCTGGAGTTGTCCCTGTAGCTTACAGGAGGGTACCCTGCGGAAGAAGGGG
AGGCATCAGGTTCACAATCAATGGCCATTCCTACTTCAACCTAGTGTTGA
TCACCAACGTTGGTGGTGCTGGTGATGTTCATGCTGTTTCAATCAAAGGA
TCTAGAACTGGCTGGCAGCCAATGTCAAGAAACTGGGGCCAAAACTGGCA
AAGCAACACTTATCTCAATGGCCAAAGCCTGTCATTTGAGGTCACCACAA
GCGATGGCCGTACTGTGACTTCCTACAATGTTGCCCCTGCTGGCTGGTCC
TTTGGCCGAACTTACTCCGGTGCTCAATTCCGCTAGAGCCACCAAGACCA
TTAGNAGATTGGGTTTTAACACCTTTTTTAGCTATATATTCGTGTACTAA
GTAGTATATTTTAGTATGAAATTTTAGCATACTAGGGTATATATATATAT
ATATNAATATAGAAGTAGCTATGTGGCTAGTTTTTGGCTTCCAGGGTCAA
AAATGAAAAAAAAGGGCTTATTTTAAAATGGCTTATTTTTTTCATTTTCA
TTGATTTTTATG
back to top