CF417071

Overview
NameCF417071
Unique NameCF417071
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF417071_ssr538 microsatellite CF417071_ssr538:538..553. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10454 contig Csv1_Contig10454:381..1040. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXB14_ORYSJ (Putative expansin-B14 OS=Oryza sativa subsp. japonica GN=EXPB14 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.572e-14
Identity = 51/150 (34.00%), Postives = 71/150 (47.33%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIAQ-------YRAGVVPVAYRRVPCGRRG---GIRFTINGHSYFNLVLITNVGGAGDVHAVSI-----KGSRTGWQPMSRNWGQNWQSNTYLNGQS-----LSFEVTTSDGRTVTSYNVAPAGWSFGRTY 415
            GG C     HFDLS   F  +A+         AG +PV Y RVPC  +G     R     + Y+  VL+ +  G GD+ AV +      G    W  M ++WG  W+ N+   G +     +S  +T+  GRT+ + NV PAGW  G TY
Sbjct:  117 GGACLEEPVHFDLSGTAFGAMAKPGQDDQLRNAGKLPVQYARVPCKWQGVDIAFRVDAGSNQYYLAVLVEDEDGDGDLSAVDLMQSGGSGGGGSWAAMQQSWGAVWKYNS---GPAPLQAPMSIRLTSGSGRTLVASNVIPAGWQPGGTY 263          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXB11_ORYSJ (Expansin-B11 OS=Oryza sativa subsp. japonica GN=EXPB11 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.505e-14
Identity = 50/144 (34.72%), Postives = 74/144 (51.39%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIAQ-------YRAGVVPVAYRRVPCGRRG-GIRFTIN--GHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQNWQSNTYLNGQSL----SFEVTTSDGRTVTSYNVAPAGWSFGRTY 415
            GG C     HFD+S      +A+         AG++ V YRRVPC   G  I F ++   + ++  VLI    G GD++AV +  +  GW PM +NWG  W+ N+   G++L    S  +T+  G+ + + NV PA W  G TY
Sbjct:  143 GGICLAGAAHFDMSGTSMGAMAKPGMADKLRAAGILQVQYRRVPCKYSGVNIAFRVDQGANPFYFEVLIEFEDGDGDLNAVDLMEAGCGWTPMVQNWGALWRYNSN-TGKALKAPFSLRLTSDSGKVLVANNVIPASWKPGVTY 285          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXB18_ORYSJ (Expansin-B18 OS=Oryza sativa subsp. japonica GN=EXPB18 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.766e-13
Identity = 52/146 (35.62%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIA------QYRA-GVVPVAYRRVPCGRRGGIRFTI-----NGHSYFNLVLITNVGGAGDVHAVSIK--GSRTGWQPMSRNWGQNWQSNTYLNGQS-LSFEVTTSDGRTVTSYNVAPAGWSFGRTYS 418
            GG C     HFDLS   F  +A      Q RA GV+ + Y RVPC   GG+  T      +  SYF  VL+    G GD+  + +   G+   W PM ++WG  W+ +     Q+ LS  +T+S G+T+ + NV P+GW  G +Y+
Sbjct:  116 GGPCLSEPVHFDLSGTAFGAMANPGQADQLRAAGVLQIQYNRVPCNW-GGVMLTFAVDAGSNPSYF-AVLVKYENGDGDLSGMDLMQTGAGAAWTPMQQSWGAVWKLSAGAALQAPLSIRLTSSSGKTLVASNVIPSGWKPGASYT 259          
BLAST of CF417071 vs. ExPASy Swiss-Prot
Match: EXB15_ORYSJ (Expansin-B15 OS=Oryza sativa subsp. japonica GN=EXPB15 PE=3 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.051e-12
Identity = 49/144 (34.03%), Postives = 72/144 (50.00%), Query Frame = 2
Query:   26 GGWCNPPQQHFDLSQPVFQHIA------QYRA-GVVPVAYRRVPCGRRGGIRFT----INGHSYFNLVLITNVGGAGDVHAVSIK--GSRTGWQPMSRNWGQNWQSNTYLNGQS-LSFEVTTSDGRTVTSYNVAPAGWSFGRTY 415
            GG C     HFDLS   F  +A      Q RA GV+ + Y RVPC   GG++ T    +  +  +  VL+    G GD+  V +   G+   W  M ++WG  W+ N     Q+  S  +T+S G+T+ + NV P+GW  G +Y
Sbjct:  116 GGPCLSEPVHFDLSGTAFGAMANPGQADQLRAAGVLQIQYNRVPCNW-GGVKLTFVVDVGSNPNYFAVLVKYENGDGDLSGVELMQTGAGAAWTQMQQSWGAVWKLNAGSALQAPFSIRLTSSSGKTLVASNVIPSGWKPGMSY 258          
The following BLAST results are available for this feature:
BLAST of CF417071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
EXB14_ORYSJ5.572e-1434.00Putative expansin-B14 OS=Oryza sativa subsp. japon... [more]
EXB11_ORYSJ9.505e-1434.72Expansin-B11 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXB18_ORYSJ2.766e-1335.62Expansin-B18 OS=Oryza sativa subsp. japonica GN=EX... [more]
EXB15_ORYSJ1.051e-1234.03Expansin-B15 OS=Oryza sativa subsp. japonica GN=EX... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-001 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-001_A1 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417071 ID=CF417071|Name=CF417071|organism=Citrus sinensis|type=EST|length=662bp
GAACAACGCCCTTCCCAACAATGCAGGCGGTTGGTGCAATCCTCCGCAGC
AACATTTTGATCTCTCTCAGCCTGTGTTCCAACACATTGCTCAATACAGA
GCTGGAGTTGTCCCTGTAGCTTACAGGAGGGTACCCTGCGGAAGAAGGGG
AGGCATCAGGTTCACAATCAATGGCCATTCCTACTTCAACCTAGTGTTGA
TCACCAACGTTGGTGGTGCTGGTGATGTTCATGCTGTTTCAATCAAAGGA
TCTAGAACTGGCTGGCAGCCAATGTCAAGAAACTGGGGCCAAAACTGGCA
AAGCAACACTTATCTCAATGGCCAAAGCCTGTCATTTGAGGTCACCACAA
GCGATGGCCGTACTGTGACTTCCTACAATGTTGCCCCTGCTGGCTGGTCC
TTTGGCCGAACTTACTCCGGTGCTCAATTCCGCTAGAGCCACCAAGACCA
TTAGNAGATTGGGTTTTAACACCTTTTTTAGCTATATATTCGTGTACTAA
GTAGTATATTTTAGTATGAAATTTTAGCATACTAGGGTATATATATATAT
ATATNAATATAGAAGTAGCTATGTGGCTAGTTTTTGGCTTCCAGGGTCAA
AAATGAAAAAAAAGGGCTTATTTTAAAATGGCTTATTTTTTTCATTTTCA
TTGATTTTTATG
back to top