CF417742
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF417742 vs. ExPASy Swiss-Prot
Match: RANB9_XENTR (Ran-binding protein 9 OS=Xenopus tropicalis GN=ranbp9 PE=2 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 3.001e-14 Identity = 25/80 (31.25%), Postives = 40/80 (50.00%), Query Frame = 2 Query: 248 FLVVSPDKLSVKYTSVNLHGHDVGVVQANKPAPVKRLVYYFEIYVEDAGAKGQIAIGFTSESFKMRRQPGWEANSCGYHG 487 +L +S L V Y D V++ P P ++YFE+ + G G + IG +++ + R PGW+ +S GYHG Sbjct: 32 YLGLSHGNLRVHYKGHGKTSKDAASVRSTHPIPAACGIFYFEVKIISKGRDGYMGIGLSTQGVNLSRLPGWDKHSYGYHG 111 HSP 2 Score: 44.2838 bits (103), Expect = 3.001e-14 Identity = 18/46 (39.13%), Postives = 27/46 (58.70%), Query Frame = 1 Query: 523 GEAFGPTFTTNDTVGGGINYASQEFFFTKNGSLVGAVYKDIKGPLF 660 G+ +GPTFTT D +G +N F+TKNG +G + D+ L+ Sbjct: 123 GQPYGPTFTTGDVIGCCVNLIDNTCFYTKNGHSLGIAFTDLPPNLY 168 The following BLAST results are available for this feature:
BLAST of CF417742 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF417742 ID=CF417742; Name=CF417742; organism=Citrus sinensis; type=EST; length=660bpback to top |