CF503812

Overview
NameCF503812
Unique NameCF503812
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length511
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7698 contig Csv1_Contig7698:69..579. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: AZIN1_HUMAN (Antizyme inhibitor 1 OS=Homo sapiens GN=AZIN1 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.354e-20
Identity = 51/123 (41.46%), Postives = 71/123 (57.72%), Query Frame = 1
Query:  139 FYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSG 507
            F++ DLG +V  ++   + +  I P Y VKCN            G+ F C S++E+  V  LGV P+ IIY +PCK VS IKYAA VGVN+ T D+  EL KI   HP + +L+ I + D+ G
Sbjct:   40 FFVGDLGKIVKKHSQWQNVVAQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIG 162          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_CAEEL (Ornithine decarboxylase OS=Caenorhabditis elegans GN=odc-1 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.768e-20
Identity = 55/156 (35.26%), Postives = 82/156 (52.56%), Query Frame = 1
Query:   34 QVMGGQRVTTVVTK-DELTEFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPD 498
            +++G  ++  +  + D+L         K  + ++  F L+DL  ++  +      LPMI P YAVKCN            G  FDC S+ EI+ V+  GVS +RIIYANPCK  S I +A    V + T D+ EEL KI   HP +++++RI   D
Sbjct:    6 EIIGDNKIGVLPKQVDQLQMCRDIAASKDLQENDSSFMLVDLDKIIERFQLWKRELPMIEPFYAVKCNTDLVLIRILASLGCGFDCASKDEIDIVMGTGVSAERIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPNAEMILRIAVSD 161          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: AZIN1_RAT (Antizyme inhibitor 1 OS=Rattus norvegicus GN=Azin1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.768e-20
Identity = 50/123 (40.65%), Postives = 71/123 (57.72%), Query Frame = 1
Query:  139 FYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSG 507
            F++ DLG +V  ++   + +  I P Y VKCN            G+ F C +++E+  V  LGVSP+ IIY +PCK  S IKYAA VGVN+ T D+  EL KI   HP + +L+ I + D+ G
Sbjct:   40 FFVGDLGKIVKKHSQWQNVVAQIKPFYMVKCNSTPAVLEILAALGTGFACSTKNEMALVQELGVSPENIIYTSPCKQASQIKYAAKVGVNIMTCDNEVELKKIARNHPNAKVLLHIATEDNIG 162          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_CRIGR (Ornithine decarboxylase OS=Cricetulus griseus GN=ODC1 PE=2 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 3.939e-20
Identity = 58/128 (45.31%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  127 DEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPDDSGA 510
            D+  FY+ DLG V+  +   +  LP + P YAVKCN                DC S++EI+ V  LGV P+R+IYANPCK VS IKYAAS GV + T DS  EL K+   HPK   L+   + DDS A
Sbjct:   35 DKDAFYVADLGDVLKKHLRWLKALP-VTPFYAVKCNDSRALVNTLAAI--TVDCASKTEIQLVQGLGVPPERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKVTKLVLRIATDDSKA 159          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR1_DROME (Ornithine decarboxylase 1 OS=Drosophila melanogaster GN=Odc1 PE=1 SV=3)

HSP 1 Score: 95.5153 bits (236), Expect = 1.497e-19
Identity = 46/99 (46.46%), Postives = 64/99 (64.65%), Query Frame = 1
Query:  196 LPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKS 492
            LP I P YAVKCN            G+ FDC S++E++ VL   VSP+RII+ANPC+PVSH++YA    V+  TVD+  E+ K+   +P S+L++R KS
Sbjct:   52 LPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKS 150          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_LEIDO (Ornithine decarboxylase OS=Leishmania donovani PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.553e-19
Identity = 52/125 (41.60%), Postives = 70/125 (56.00%), Query Frame = 1
Query:  130 EVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVL--LLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPD 498
            E PFY++DLG VV         LPM+ P++AVK N            G+ FDC S+ EI  VL   L  SPD II+ANPCK +  ++ A + GV   TVD+  E++KI    P +  +IRIK+ D
Sbjct:  256 EDPFYIIDLGRVVEQMARWRHELPMVRPYFAVKSNPQPAVLEVLSALGAGFDCASKEEIHMVLGRQLVASPDDIIFANPCKQLGDLREAQACGVTYVTVDNPLEMEKISRLMPSAHAIIRIKTND 380          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCOR_PANRE (Ornithine decarboxylase OS=Panagrellus redivivus GN=ODC PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.687e-18
Identity = 48/121 (39.67%), Postives = 67/121 (55.37%), Query Frame = 1
Query:  136 PFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPD 498
            PF +M++  +++        +P + P YAVKCN            G  FDC S++EIE V+ L V P++I+YANPCK    I +A + GV   T DSVEEL KI+  H    L++RI   D
Sbjct:   46 PFVVMNVSTIMAKVIQWQRTMPRVAPCYAVKCNDDKVLLRTLADLGMGFDCASKAEIEKVIGL-VGPEKIVYANPCKTRGFIAHAEAAGVKRMTFDSVEELTKIKQNHADPSLILRISVSD 165          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: ADC_HUMAN (Arginine decarboxylase OS=Homo sapiens GN=ADC PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.289e-18
Identity = 46/125 (36.80%), Postives = 70/125 (56.00%), Query Frame = 1
Query:  127 DEVP-FYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPD 498
            DEV  F++ DLG +V  +   +  LP + P YAVKCN            G  F C +++E+E V  +G+   +II ANPCK ++ IKYAA  G+ L + D+  EL K+   HP + +++ I + D
Sbjct:   36 DEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDD 160          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: ADC_MOUSE (Antizyme inhibitor 2 OS=Mus musculus GN=Adc PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 8.214e-18
Identity = 46/120 (38.33%), Postives = 67/120 (55.83%), Query Frame = 1
Query:  139 FYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRIKSPD 498
            F++ DLG VV  +   + +LP + P YAV CN            G  F C +++E+E V  +GV   +II ANPCK V+ IKYAA  GV L + D+  EL K+   HP + +++ I + D
Sbjct:   41 FFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQD 160          
BLAST of CF503812 vs. ExPASy Swiss-Prot
Match: DCLO_SELRU (Lysine/ornithine decarboxylase OS=Selenomonas ruminantium GN=ldc PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.796e-12
Identity = 47/135 (34.81%), Postives = 63/135 (46.67%), Query Frame = 1
Query:   82 LTEFMQSTILKRQEFDEVPFYLMDLGVVVSLYNHMISNLPMIHPHYAVKCNXXXXXXXXXXXXGSNFDCGSRSEIEAVLLLGVSPDRIIYANPCKPVSHIKYAASVGVNLTTVDSVEELDKIRNWHPKSDLLIRI 486
            L+E    T+ KR      PF +  L  V   Y  M  +LP     YA+K N            GS+FD  S  E+E +  LGV   ++IYANP K    +K AA   V   T D   E+DK+    P +D+L+RI
Sbjct:    6 LSEKEVKTLAKRIP---TPFLVASLDKVEENYQFMRRHLPRAGVFYAMKANPTPEILSLLAGLGSHFDVASAGEMEILHELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAVPGADVLVRI 137          
The following BLAST results are available for this feature:
BLAST of CF503812 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
AZIN1_HUMAN1.354e-2041.46Antizyme inhibitor 1 OS=Homo sapiens GN=AZIN1 PE=1... [more]
DCOR_CAEEL1.768e-2035.26Ornithine decarboxylase OS=Caenorhabditis elegans ... [more]
AZIN1_RAT1.768e-2040.65Antizyme inhibitor 1 OS=Rattus norvegicus GN=Azin1... [more]
DCOR_CRIGR3.939e-2045.31Ornithine decarboxylase OS=Cricetulus griseus GN=O... [more]
DCOR1_DROME1.497e-1946.46Ornithine decarboxylase 1 OS=Drosophila melanogast... [more]
DCOR_LEIDO2.553e-1941.60Ornithine decarboxylase OS=Leishmania donovani PE=... [more]
DCOR_PANRE3.687e-1839.67Ornithine decarboxylase OS=Panagrellus redivivus G... [more]
ADC_HUMAN6.289e-1836.80Arginine decarboxylase OS=Homo sapiens GN=ADC PE=2... [more]
ADC_MOUSE8.214e-1838.33Antizyme inhibitor 2 OS=Mus musculus GN=Adc PE=2 S... [more]
DCLO_SELRU8.796e-1234.81Lysine/ornithine decarboxylase OS=Selenomonas rumi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-298 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503812 ID=CF503812|Name=CF503812|organism=Citrus sinensis|type=EST|length=511bp
GGAACTCCAAGCACATTATTGCATTTGGATGCACAAGTAATGGGAGGCCA
GAGAGTCACGACGGTGGTAACAAAAGATGAGCTAACTGAATTCATGCAGT
CAACAATCTTGAAGAGACAAGAGTTCGATGAAGTACCCTTTTACCTAATG
GATTTAGGCGTTGTGGTTTCTCTCTACAATCATATGATCTCAAACCTTCC
GATGATTCATCCTCACTATGCCGTCAAGTGCAATCCCGAGCCAGCCCTTC
TCGAGGCACTTGCAGCTCTTGGCTCAAACTTTGACTGTGGAAGCCGATCC
GAGATTGAAGCTGTTTTGTTACTAGGTGTTTCACCGGATCGTATCATTTA
CGCAAACCCGTGTAAGCCTGTATCTCACATCAAGTATGCTGCGAGTGTTG
GCGTCAACTTGACAACCGTTGACTCAGTAGAGGAGCTCGACAAGATTCGG
AACTGGCATCCGAAATCTGATTTATTGATCAGGATCAAATCCCCGGATGA
TAGCGGAGCGA
back to top