CF503932
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_HUMAN (Inositol-3-phosphate synthase 1 OS=Homo sapiens GN=ISYNA1 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F +G+G+K SIVSYNHLGNNDG NLSAP FRSKE+SKSNVVDDM Sbjct: 318 FLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDM 363
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_YEAST (Inositol-3-phosphate synthase OS=Saccharomyces cerevisiae GN=INO1 PE=1 SV=3) HSP 1 Score: 77.411 bits (189), Expect = 2.478e-14 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F V AGIKP SI SYNHLGNNDG NLSAP+ FRSKEISKS+V+DD+ Sbjct: 335 FLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFRSKEISKSSVIDDI 380
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_BOVIN (Inositol-3-phosphate synthase 1 OS=Bos taurus GN=ISYNA1 PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.237e-14 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F +G+G+K SIVSYNHLGNNDG NLSAP FRSKE+SKS+VVDDM Sbjct: 318 FLIGSGLKTMSIVSYNHLGNNDGQNLSAPPQFRSKEVSKSSVVDDM 363
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_CANGA (Inositol-3-phosphate synthase OS=Candida glabrata GN=INO1 PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.211e-14 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F V AGI+P SI SYNHLGNNDG NLS+PQ FRSKEISK++VVDD+ Sbjct: 338 FLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEISKASVVDDI 383
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_RAT (Inositol-3-phosphate synthase 1 OS=Rattus norvegicus GN=Isyna1 PE=2 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.418e-14 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F +G+G+K SIVSYNHLGNNDG NLSAP FRSKE++KS+VVDDM Sbjct: 318 FLIGSGLKTMSIVSYNHLGNNDGQNLSAPLQFRSKEVTKSSVVDDM 363
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_MOUSE (Inositol-3-phosphate synthase 1 OS=Mus musculus GN=Isyna1 PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.418e-14 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F +G+G+K SIVSYNHLGNNDG NLSAP FRSKE++KS+VVDDM Sbjct: 318 FLIGSGLKTMSIVSYNHLGNNDGQNLSAPLQFRSKEVTKSSVVDDM 363
BLAST of CF503932 vs. ExPASy Swiss-Prot
Match: INO1_CANAL (Inositol-3-phosphate synthase OS=Candida albicans GN=INO1 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 1.606e-13 Identity = 35/46 (76.09%), Postives = 39/46 (84.78%), Query Frame = -3 Query: 65 FFVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDM 202 F V AGIKP SI SYNHLGNNDG NLS+P+ FRSKEISK +VVDD+ Sbjct: 327 FLVDAGIKPLSIASYNHLGNNDGYNLSSPKQFRSKEISKQSVVDDI 372 The following BLAST results are available for this feature:
BLAST of CF503932 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 27
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF503932 ID=CF503932; Name=CF503932; organism=Citrus sinensis; type=EST; length=210bpback to top |