CF504168
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF504168 vs. ExPASy Swiss-Prot
Match: YAB5_ARATH (Axial regulator YABBY 5 OS=Arabidopsis thaliana GN=YAB5 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.919e-14 Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 3 Query: 189 SSEQLCYVHCTFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLL 335 ++EQLCY+ C FC+ +LAV+VPC+SLF VTVRCGHCTNL SVNM L Sbjct: 7 ATEQLCYIPCNFCNIILAVNVPCSSLFDIVTVRCGHCTNLWSVNMAAAL 55
BLAST of CF504168 vs. ExPASy Swiss-Prot
Match: YABDL_ORYSJ (Protein DROOPING LEAF OS=Oryza sativa subsp. japonica GN=DL PE=1 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.796e-12 Identity = 36/70 (51.43%), Postives = 45/70 (64.29%), Query Frame = 3 Query: 177 DHLSSSEQLCYVHCTFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMR-GLLLPAANQLHLGHPFFTP 383 D +S SE LCYV CT+C+TVLAV VPC L TVTV+CGHC NL ++ R ++ P + H PF P Sbjct: 2 DLVSPSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPMVQPLSPTDHPLGPFQGP 71
BLAST of CF504168 vs. ExPASy Swiss-Prot
Match: YAB4_ARATH (Axial regulator YABBY 4 OS=Arabidopsis thaliana GN=YAB4 PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.593e-11 Identity = 33/58 (56.90%), Postives = 39/58 (67.24%), Query Frame = 3 Query: 198 QLCYVHCTFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVN-MRGLLLPAANQLHLGH 368 Q+C+V C FC T+L VSVP TSL VTVRCGHCT+LLSVN M+ +P L H Sbjct: 20 QICHVQCGFCTTILLVSVPFTSLSMVVTVRCGHCTSLLSVNLMKASFIPLHLLASLSH 77 The following BLAST results are available for this feature:
BLAST of CF504168 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504168 ID=CF504168; Name=CF504168; organism=Citrus sinensis; type=EST; length=384bpback to top |