CF504355
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504355 vs. ExPASy Swiss-Prot
Match: DRE2D_ARATH (Dehydration-responsive element-binding protein 2D OS=Arabidopsis thaliana GN=DREB2D PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.645e-11 Identity = 30/52 (57.69%), Postives = 40/52 (76.92%), Query Frame = 2 Query: 155 YKGVRKRKWGKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSA 310 YKGVR+R WGK+V+EIR PN AR+WLG++DT+ +AA A+D+A L G A Sbjct: 42 YKGVRQRTWGKWVAEIREPNRGARLWLGTFDTSREAALAYDSAARKLYGPEA 93
BLAST of CF504355 vs. ExPASy Swiss-Prot
Match: CRF5_ARATH (Ethylene-responsive transcription factor CRF5 OS=Arabidopsis thaliana GN=CRF5 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.645e-11 Identity = 27/54 (50.00%), Postives = 42/54 (77.78%), Query Frame = 2 Query: 152 RYKGVRKRKWGKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSAK 313 +Y+GVR+R WGK+ +EIR P+SR R+WLG++ TAE+AA +D A ++G +A+ Sbjct: 98 KYRGVRQRPWGKFAAEIRDPSSRTRLWLGTFATAEEAAIGYDRAAIRIKGHNAQ 151 The following BLAST results are available for this feature:
BLAST of CF504355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504355 ID=CF504355; Name=CF504355; organism=Citrus sinensis; type=EST; length=316bpback to top |