CF504413
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504413 vs. ExPASy Swiss-Prot
Match: GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.165e-12 Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 1 Query: 1 RGWVFPNNGRQLRIGVPNRVSYRDFV----FKVNGTDIVHGYCIDVFLAAVRLLPYAVPYKFIPYGDGHKNP--TYSELINQITTG 240 +GW P NG++LRIGVP R+ + D V + + +V G+CID F A ++ +PY V Y+F P+ + P +++L++Q+ G Sbjct: 443 KGWEIPTNGKKLRIGVPKRIGFTDLVKVTRDPITNSTVVKGFCIDFFEAVIQAMPYDVSYEFFPFEKPNGEPAGNHNDLVHQVYLG 528
BLAST of CF504413 vs. ExPASy Swiss-Prot
Match: GLR25_ARATH (Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.741e-11 Identity = 33/86 (38.37%), Postives = 51/86 (59.30%), Query Frame = 1 Query: 1 RGWVFPNNGRQLRIGVPNRVSYRDFV--FKVNGTDI--VHGYCIDVFLAAVRLLPYAVPYKFIPYG--DGHKNPTYSELINQITTG 240 +GW FP N ++LRI VP + + +FV K T++ V G+CIDVF + +PYAV Y++IP+ DG +Y E++ + G Sbjct: 447 KGWEFPTNAKKLRIAVPKKDGFNNFVEVTKDENTNVPTVTGFCIDVFNTVMSQMPYAVSYEYIPFDTPDGKPRGSYDEMVYNVFLG 532 The following BLAST results are available for this feature:
BLAST of CF504413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504413 ID=CF504413; Name=CF504413; organism=Citrus sinensis; type=EST; length=338bpback to top |