CF504542
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.034e-12 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VE+PLY+LV T+QTI PDS+GAIDGHLREVGLTFHLLK Sbjct: 228 PIPQVEKPLYELVWTAQTIAPDSEGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.034e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +ERPL++LVS +QT+LPDS GAIDGHLREVGLTFHLLK Sbjct: 228 PIPEIERPLFELVSAAQTLLPDSHGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.034e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VERPL+Q+V+ +QT+LPDS GAIDGHLREVGLTFHLLK Sbjct: 228 PVVGVERPLFQIVTAAQTLLPDSHGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.034e-12 Identity = 33/42 (78.57%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VE+PL++LV T+QTILPDS+GAIDGHLREVGLTFHLLK Sbjct: 228 PLPQVEKPLFELVWTAQTILPDSEGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS7_SOYBN (Chalcone synthase 7 OS=Glycine max GN=CHS7 PE=3 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 3.034e-12 Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VE+PLY+LV T+QTI PDS+GAIDGHLREVGLTFHLLK Sbjct: 228 PIPQVEKPLYELVWTAQTIAPDSEGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.963e-12 Identity = 32/43 (74.42%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 45 PDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 PD S E+P++++VS +QTILPDSDGAIDGHLREVG+TFHLLK Sbjct: 232 PDVSAGEKPIFEMVSAAQTILPDSDGAIDGHLREVGITFHLLK 274
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_PHAVU (Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.963e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+PL++LV T+QTI PDSDGAIDGHLREVGLTFHLLK Sbjct: 228 PIPQIEKPLFELVWTAQTIAPDSDGAIDGHLREVGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHSY_PINSY (Chalcone synthase OS=Pinus sylvestris GN=CHS PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.759e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VE+P ++L+ T+QTILPDSDGAIDGHLREVGLTFHLLK Sbjct: 233 PVPEVEKPCFELMWTAQTILPDSDGAIDGHLREVGLTFHLLK 274
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.759e-12 Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P VE+P ++L+ T+QTILPDSDGAIDGHLREVGLTFHLLK Sbjct: 233 PIPQVEKPCFELMWTAQTILPDSDGAIDGHLREVGLTFHLLK 274
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.828e-12 Identity = 30/37 (81.08%), Postives = 36/37 (97.30%), Query Frame = 3 Query: 60 ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLK Sbjct: 239 EKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLK 275 The following BLAST results are available for this feature:
BLAST of CF504542 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504542 ID=CF504542; Name=CF504542; organism=Citrus sinensis; type=EST; length=172bpback to top |