CF504542
Overview
Analyses
This EST is derived from or has results from the following analyses
Libraries
Alignments
Homology
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS2_TRISU (Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLK Sbjct: 228 PVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLK Sbjct: 228 PVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS2_MEDSA (Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLK Sbjct: 228 PVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLK Sbjct: 228 PVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 P +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLK Sbjct: 228 PIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: ACS4_RUTGR (Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 30/42 (71.43%), Postives = 35/42 (83.33%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 PD+S+ER LY LVS SQ +LPDSDGAI+GH+RE GLT HL K Sbjct: 228 PDSSIERALYYLVSASQMLLPDSDGAIEGHIREEGLTVHLKK 269
BLAST of CF504542 vs. ExPASy Swiss-Prot
Match: ACS3_RUTGR (Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.761e-11 Identity = 30/42 (71.43%), Postives = 35/42 (83.33%), Query Frame = 3 Query: 45 PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLK 170 PD+S+ER LY LVS SQ +LPDSDGAI+GH+RE GLT HL K Sbjct: 228 PDSSIERALYYLVSASQMLLPDSDGAIEGHIREEGLTVHLKK 269 The following BLAST results are available for this feature:
BLAST of CF504542 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 97
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF504542 ID=CF504542; Name=CF504542; organism=Citrus sinensis; type=EST; length=172bpback to top |