CF509651
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_BORHD (Chaperone protein dnaK OS=Borrelia hermsii (strain DAH) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.8265 bits (242), Expect = 1.753e-20 Identity = 45/57 (78.95%), Postives = 51/57 (89.47%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAG+IAGLDV RI+NEPTAA+LAYG EKKN E + V+DLGGGTF Sbjct: 143 PAYFNDAQRQATKDAGKIAGLDVKRIVNEPTAAALAYGIEKKNEEIVAVYDLGGGTF 199
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_RUBXD (Chaperone protein dnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 46/57 (80.70%), Postives = 53/57 (92.98%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYF D+QR ATKDAGRIAGL+V RIINEPTAA+LAYG +K+N++TILVFDLGGGTF Sbjct: 142 PAYFEDAQRQATKDAGRIAGLNVKRIINEPTAAALAYGLDKENDQTILVFDLGGGTF 198
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_RHOCA (Chaperone protein dnaK OS=Rhodobacter capsulatus GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 45/57 (78.95%), Postives = 54/57 (94.74%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAG+IAGL+VLRIINEPTAA+LAYG +KK+++TI V+DLGGGTF Sbjct: 142 PAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKDSKTIAVYDLGGGTF 198
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_PARDP (Chaperone protein dnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 45/57 (78.95%), Postives = 54/57 (94.74%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAG+IAGL+VLRIINEPTAA+LAYG +KK+++TI V+DLGGGTF Sbjct: 142 PAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKDSKTIAVYDLGGGTF 198
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_HYPNA (Chaperone protein dnaK OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 46/57 (80.70%), Postives = 52/57 (91.23%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAGRIAGL+VLRIINEPTAA+LAYG +K N+TI V+DLGGGTF Sbjct: 143 PAYFNDAQRQATKDAGRIAGLEVLRIINEPTAAALAYGLDKGGNKTIAVYDLGGGTF 199
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_DESPS (Chaperone protein dnaK OS=Desulfotalea psychrophila GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 48/57 (84.21%), Postives = 50/57 (87.72%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFNDSQR ATKDAG+IAGLDV RIINEPTAASLAYG +KK E I VFDLGGGTF Sbjct: 143 PAYFNDSQRQATKDAGKIAGLDVKRIINEPTAASLAYGLDKKVEEKIAVFDLGGGTF 199
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_DESOH (Chaperone protein dnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYF+DSQR ATKDAG+IAGL+VLRIINEPTAASLAYG +KK +E I VFDLGGGTF Sbjct: 143 PAYFSDSQRQATKDAGKIAGLNVLRIINEPTAASLAYGLDKKKDEKIAVFDLGGGTF 199
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_CLOTH (Chaperone protein dnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.4413 bits (241), Expect = 2.289e-20 Identity = 46/57 (80.70%), Postives = 54/57 (94.74%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYF+DSQR ATKDAGRIAGL+VLRIINEPTAA+LAYG +K++++ ILVFDLGGGTF Sbjct: 119 PAYFSDSQRQATKDAGRIAGLEVLRIINEPTAAALAYGLDKESDQKILVFDLGGGTF 175
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_RHOS5 (Chaperone protein dnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 2.990e-20 Identity = 45/57 (78.95%), Postives = 53/57 (92.98%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAG+IAGL+VLRIINEPTAA+LAYG +KK+ +TI V+DLGGGTF Sbjct: 142 PAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKDTKTIAVYDLGGGTF 198
BLAST of CF509651 vs. ExPASy Swiss-Prot
Match: DNAK_RHOS4 (Chaperone protein dnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=2 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 2.990e-20 Identity = 45/57 (78.95%), Postives = 53/57 (92.98%), Query Frame = 3 Query: 3 PAYFNDSQRTATKDAGRIAGLDVLRIINEPTAASLAYGFEKKNNETILVFDLGGGTF 173 PAYFND+QR ATKDAG+IAGL+VLRIINEPTAA+LAYG +KK+ +TI V+DLGGGTF Sbjct: 142 PAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKDTKTIAVYDLGGGTF 198 The following BLAST results are available for this feature:
BLAST of CF509651 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 500
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF509651 ID=CF509651; Name=CF509651; organism=Citrus sinensis; type=EST; length=183bpback to top |