CF509796
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF509796 vs. ExPASy Swiss-Prot
Match: ASAP3_MOUSE (Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Asap3 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.563e-11 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 2 Query: 182 PENRECADCKAKGPRWASVNLGIFICMQCSGIHRSLGVHISKVRSATLD 328 P N C DC A P W S NLG+ C+QCSG+HR LGV S+++S TLD Sbjct: 435 PGNDRCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRIQSLTLD 483
BLAST of CF509796 vs. ExPASy Swiss-Prot
Match: ADAP2_HUMAN (Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens GN=ADAP2 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.459e-11 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 2 Query: 146 RHRKILEGLLKLPE--NRECADCKAKGPRWASVNLGIFICMQCSGIHRSLGVHISKVRSATLDTW 334 R++K L LL+ P+ N CADC A P WAS LGIFIC+ C G+HR+ IS+V+S LD W Sbjct: 6 RNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNF-PDISRVKSVRLDFW 69 The following BLAST results are available for this feature:
BLAST of CF509796 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF509796 ID=CF509796; Name=CF509796; organism=Citrus sinensis; type=EST; length=337bpback to top |