CF510209
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF510209 vs. ExPASy Swiss-Prot
Match: RS14_CAEEL (40S ribosomal protein S14 OS=Caenorhabditis elegans GN=rps-14 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.709e-15 Identity = 34/58 (58.62%), Postives = 48/58 (82.76%), Query Frame = 3 Query: 51 AMSRRKTREPKEENVTLGPAVRDGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITG 224 A +R+ + ++ V+LGP ++GE +FGVAHIFASFNDTF+H+TD+SGRET+VR+TG Sbjct: 2 APARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTG 59
BLAST of CF510209 vs. ExPASy Swiss-Prot
Match: RS14_PIG (40S ribosomal protein S14 (Fragment) OS=Sus scrofa GN=RPS14 PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.373e-14 Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = 3 Query: 63 RKTREPKEENV-TLGPAVRDGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITG 224 RK +E KEE V +LGP V +GE+VFGV HIFAS NDTF+HVTDLSG E++ R+TG Sbjct: 2 RKGKEKKEEQVISLGPQVAEGENVFGVCHIFASPNDTFVHVTDLSGXESICRVTG 56
BLAST of CF510209 vs. ExPASy Swiss-Prot
Match: RS14_SCHPO (40S ribosomal protein S14 OS=Schizosaccharomyces pombe GN=rps14a PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.145e-13 Identity = 31/42 (73.81%), Postives = 39/42 (92.86%), Query Frame = 3 Query: 99 LGPAVRDGEHVFGVAHIFASFNDTFIHVTDLSGRETLVRITG 224 +GP +R GE VFGVAHIFASFNDTF+H+TDL+G+ET+VR+TG Sbjct: 5 VGPQIRSGELVFGVAHIFASFNDTFVHITDLTGKETIVRVTG 46 The following BLAST results are available for this feature:
BLAST of CF510209 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 23
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF510209 ID=CF510209; Name=CF510209; organism=Citrus sinensis; type=EST; length=225bpback to top |