CF832071
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832071 vs. ExPASy Swiss-Prot
Match: GSK3_DICDI (Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2) HSP 1 Score: 76.6406 bits (187), Expect = 1.691e-13 Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = -2 Query: 587 YSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELSGASPELVNKLIPDHVKRQLGL 784 Y PS R +E CAHPFFDELR+P LP+G+PLPPLFNF E + P+L LIP H Q+ L Sbjct: 322 YDPSSRLKPVEICAHPFFDELRDPKTCLPDGKPLPPLFNFTIAEQTSIGPKLAKTLIPSHAMNQIEL 388
BLAST of CF832071 vs. ExPASy Swiss-Prot
Match: GSK3A_MOUSE (Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 1.096e-12 Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = -2 Query: 590 QYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLG 787 +Y+PS R + LEACAH FFDELR A+LPN RPLPPLFNF P L LIP H++ G Sbjct: 386 EYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPAG 451
BLAST of CF832071 vs. ExPASy Swiss-Prot
Match: GSK3A_HUMAN (Glycogen synthase kinase-3 alpha OS=Homo sapiens GN=GSK3A PE=1 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 1.096e-12 Identity = 37/73 (50.68%), Postives = 44/73 (60.27%), Query Frame = -2 Query: 569 QYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPA 787 +Y+PS R + LEACAH FFDELR +LPN RPLPPLFNF P L LIP H++ G L P+ Sbjct: 385 EYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPS 457
BLAST of CF832071 vs. ExPASy Swiss-Prot
Match: GSK3A_RAT (Glycogen synthase kinase-3 alpha OS=Rattus norvegicus GN=Gsk3a PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 3.189e-12 Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = -2 Query: 590 QYSPSLRCTALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLG 787 +Y+PS R + LEACAH FFDELR +LPN RPLPPLFNF P L LIP H++ G Sbjct: 385 EYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPSG 450 The following BLAST results are available for this feature:
BLAST of CF832071 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 24
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832071 ID=CF832071; Name=CF832071; organism=Citrus sinensis; type=EST; length=788bpback to top |