CF832366
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832366 vs. ExPASy Swiss-Prot
Match: RS37_YEAST (40S ribosomal protein S31 OS=Saccharomyces cerevisiae GN=UBI3 PE=1 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 1.112e-11 Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = -2 Query: 171 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFSRHYCGKCGLPY 317 LAVL +YKVD GKV +LR+EC N CGAG F+ANH R YCGKC Y Sbjct: 24 LAVLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSVY 72
BLAST of CF832366 vs. ExPASy Swiss-Prot
Match: RS27A_DICDI (40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.236e-11 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = -2 Query: 183 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFSRHYCGKC 317 LAVL++YK D++GK++R+ +ECP CGAG FMA H +R YCGKC Sbjct: 25 LAVLKYYKFDENGKIKRVLRECPAETCGAGVFMAQHANRQYCGKC 69 The following BLAST results are available for this feature:
BLAST of CF832366 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 122
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832366 ID=CF832366; Name=CF832366; organism=Citrus sinensis; type=EST; length=645bpback to top |