CF832570

Overview
NameCF832570
Unique NameCF832570
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF832570_ssr15 microsatellite CF832570_ssr15:15..26. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5598 contig Csv1_Contig5598:17..659. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_PIG (Macrophage migration inhibitory factor OS=Sus scrofa GN=MIF PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 6.967e-14
Identity = 40/115 (34.78%), Postives = 60/115 (52.17%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V     LSE T  +   +GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I +YD   +N GWNGSTF
Sbjct:    1 MPMFVVNTNVPRASVP-DGFLSELTQQLVQAMGKPAQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRIYINYYDMNAANVGWNGSTF 114          
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_SHEEP (Macrophage migration inhibitory factor OS=Ovis aries GN=MIF PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.188e-13
Identity = 41/115 (35.65%), Postives = 60/115 (52.17%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V    +LSE T  +A   GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I F D   +N GWNGSTF
Sbjct:    1 MPMFVVNTNVPRASVP-DGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTF 114          
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_BOVIN (Macrophage migration inhibitory factor OS=Bos taurus GN=MIF PE=1 SV=6)

HSP 1 Score: 76.6406 bits (187), Expect = 1.188e-13
Identity = 41/115 (35.65%), Postives = 60/115 (52.17%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V    +LSE T  +A   GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I F D   +N GWNGSTF
Sbjct:    1 MPMFVVNTNVPRASVP-DGLLSELTQQLAQATGKPAQYIAVHVVPDQLMTFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLTERLRISPDRIYINFCDMNAANVGWNGSTF 114          
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_MACMU (Macrophage migration inhibitory factor OS=Macaca mulatta GN=MIF PE=3 SV=4)

HSP 1 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V     LSE T  +A   GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I +YD   +N GWN STF
Sbjct:    1 MPMFIVNTNVPRASVP-DGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF 114          
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_MACFA (Macrophage migration inhibitory factor OS=Macaca fascicularis GN=MIF PE=3 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V     LSE T  +A   GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I +YD   +N GWN STF
Sbjct:    1 MPMFIVNTNVPRASVP-DGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF 114          
BLAST of CF832570 vs. ExPASy Swiss-Prot
Match: MIF_HUMAN (Macrophage migration inhibitory factor OS=Homo sapiens GN=MIF PE=1 SV=4)

HSP 1 Score: 75.485 bits (184), Expect = 2.647e-13
Identity = 40/115 (34.78%), Postives = 59/115 (51.30%), Query Frame = 2
Query:   83 MPCLNISTNVKLDGVDTSSILSEATSTVANIIGKPEAYVMIVLKGSVPMSFGGTEDPAAYGELVSIGGLNPDVNKKLSAAISAILEKKLSVPKSRFFIKFYDTKGSNFGWNGSTF 427
            MP   ++TNV    V     LSE T  +A   GKP  Y+ + +     M+FGG+ +P A   L SIG +    N+  S  +  +L ++L +   R +I +YD   +N GWN STF
Sbjct:    1 MPMFIVNTNVPRASVP-DGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTF 114          
The following BLAST results are available for this feature:
BLAST of CF832570 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
MIF_PIG6.967e-1434.78Macrophage migration inhibitory factor OS=Sus scro... [more]
MIF_SHEEP1.188e-1335.65Macrophage migration inhibitory factor OS=Ovis ari... [more]
MIF_BOVIN1.188e-1335.65Macrophage migration inhibitory factor OS=Bos taur... [more]
MIF_MACMU2.647e-1334.78Macrophage migration inhibitory factor OS=Macaca m... [more]
MIF_MACFA2.647e-1334.78Macrophage migration inhibitory factor OS=Macaca f... [more]
MIF_HUMAN2.647e-1334.78Macrophage migration inhibitory factor OS=Homo sap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_02B03_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa02B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832570 ID=CF832570; Name=CF832570; organism=Citrus sinensis; type=EST; length=643bp
AGAAAGAAACCATTAAAGAAAGAAAGAGAGTGGTTAGGGGGAAGCTCCAA
GAGTAGGGTTTTCCGTCGGAAGTTTCGAGAAGATGCCTTGCTTGAACATT
TCAACTAACGTCAAACTCGATGGCGTTGACACGTCATCCATCCTCTCCGA
GGCCACCTCCACTGTCGCCAACATCATCGGCAAACCCGAGGCCTACGTGA
TGATTGTGTTGAAGGGATCAGTACCTATGTCTTTTGGTGGAACTGAGGAC
CCGGCAGCTTATGGTGAGTTGGTGTCCATTGGTGGCCTTAACCCTGATGT
GAACAAGAAGCTGAGTGCTGCAATTTCTGCAATTCTTGAAAAGAAGCTGT
CGGTACCCAAGTCACGATTCTTCATCAAGTTTTATGACACAAAGGGTTCA
AACTTTGGATGGAATGGATCCACCTTCTAGATATTATTCTCAAAGCATGG
CGCCATGAACTCTGACAATTGTCTTATCTATATGGTGATTACAATCTTTA
GAACAATGTTAATAATTGGCTGAATATTGTGTAATTTCTCCTATGATGTG
TTTTCTTCTCGTTGGTGCTAGCCAACAATATTGTGGAATAGGAACTGTTT
GGTTTATGGAGTAATATTACATTTGTTAAAAAAAAAAAAAAAA
back to top