CF832748
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832748 vs. ExPASy Swiss-Prot
Match: H2B2D_HUMAN (Putative histone H2B type 2-D OS=Homo sapiens GN=HIST2H2BD PE=5 SV=3) HSP 1 Score: 73.1738 bits (178), Expect = 6.575e-13 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -3 Query: 337 VHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 471 VHPD GI KAMGIMNSF+NDIFE++A EASRLA YNK+ TITSR Sbjct: 49 VHPDTGIWCKAMGIMNSFLNDIFERIAGEASRLAHYNKRSTITSR 93
BLAST of CF832748 vs. ExPASy Swiss-Prot
Match: H2B2C_HUMAN (Putative histone H2B type 2-C OS=Homo sapiens GN=HIST2H2BC PE=5 SV=3) HSP 1 Score: 73.1738 bits (178), Expect = 6.575e-13 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -3 Query: 337 VHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR 471 VHPD GI KAMGIMNSF+NDIFE++A EASRLA YNK+ TITSR Sbjct: 49 VHPDTGIWCKAMGIMNSFLNDIFERIAGEASRLAHYNKRSTITSR 93
BLAST of CF832748 vs. ExPASy Swiss-Prot
Match: H2BV_BOVIN (Histone H2B subacrosomal variant OS=Bos taurus GN=SUBH2BV PE=1 SV=3) HSP 1 Score: 70.0922 bits (170), Expect = 5.566e-12 Identity = 35/77 (45.45%), Postives = 54/77 (70.13%), Query Frame = -3 Query: 241 VHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 471 V P GISS+ + I+N+ IND+FE+++ EA L Y K+ T+T +I+ AV L+LP +LAK+AV+ G +AV ++ S Sbjct: 46 VVPQKGISSRTIDIINTMINDMFERISTEACNLMYYRKRCTLTPEDIEKAVYLLLPEKLAKYAVAFGKEAVQRYVRS 122
BLAST of CF832748 vs. ExPASy Swiss-Prot
Match: H2BV_MOUSE (Histone H2B subacrosomal variant OS=Mus musculus GN=Subh2bv PE=1 SV=3) HSP 1 Score: 66.2402 bits (160), Expect = 8.037e-11 Identity = 38/77 (49.35%), Postives = 52/77 (67.53%), Query Frame = -3 Query: 241 VHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 471 V P+ GISS ++ IMN INDIFE++A EA + K+ T+T +IQ AV L+LP +LA AV+ G+KAV +F S Sbjct: 47 VVPNRGISSYSVDIMNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRFIHS 123 The following BLAST results are available for this feature:
BLAST of CF832748 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 204
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832748 ID=CF832748; Name=CF832748; organism=Citrus sinensis; type=EST; length=473bpback to top |