CF832859
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF832859 vs. ExPASy Swiss-Prot
Match: SPEA_VIBPA (Biosynthetic arginine decarboxylase OS=Vibrio parahaemolyticus GN=speA PE=3 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 5.988e-16 Identity = 42/101 (41.58%), Postives = 61/101 (60.40%), Query Frame = 2 Query: 2 YHVTLSIFTSIPDYWAIA*LFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGG---GTSLPLHEMVGGGCGERGPYYLGMFLGGAYEEALGGVHNLFG 295 + V S+F S+PD W I +FP++P+ L + R V+ D+TCDSDG ID ++ G ++LP+ + PY +G FL GAY+E LG +HNLFG Sbjct: 468 FFVNFSLFQSLPDAWGIDQVFPVLPLSGLGDAEERRAVMLDITCDSDGAIDHYVDGQGIESTLPV-----PAWSKDKPYLMGFFLVGAYQEILGDMHNLFG 563
BLAST of CF832859 vs. ExPASy Swiss-Prot
Match: SPEA_AERHH (Biosynthetic arginine decarboxylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=speA PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 1.334e-15 Identity = 42/107 (39.25%), Postives = 63/107 (58.88%), Query Frame = 2 Query: 17 SIFTSIPDYWAIA*LFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGG---GTSLPLHEMVGGGCGERGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSD 328 S+F S+PD W I +FP++P+ L+ RG+L D+TCDSDG+++ ++ G ++LP+ GE ++G FL GAY+E LG +HNLFG V D Sbjct: 465 SLFQSLPDAWGIGQVFPVMPLAGLERPLTRRGILMDITCDSDGQVEHYVDGLGVESTLPMPVY-----GEHEECHVGFFLVGAYQEILGDLHNLFGDTHCAEVWLDD 566 The following BLAST results are available for this feature:
BLAST of CF832859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 102
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832859 ID=CF832859; Name=CF832859; organism=Citrus sinensis; type=EST; length=381bpback to top |