CF834295

Overview
NameCF834295
Unique NameCF834295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:1033..1629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_PICSI (S-adenosylmethionine synthetase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.954e-61
Identity = 111/131 (84.73%), Postives = 121/131 (92.37%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RC+VQVSYAIGVPEPLS+FVDSYGTG IPDKEIL+++KE+ DFRPGM+TINLDLKRGGNGRF K AAYGHFGRDDPDFTWE VKPLKW+K QA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVAAGLARRCLVQVSYAIGVPEPLSVFVDSYGTGSIPDKEILELIKENFDFRPGMITINLDLKRGGNGRFQKTAAYGHFGRDDPDFTWETVKPLKWDKAQA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 5.039e-61
Identity = 114/131 (87.02%), Postives = 122/131 (93.13%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKE+ DFRPGM+ INLDLKRGGN RFLK AAYGHFGR+DPDFTWEVVKPLK+EK +A
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKFEKVEA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_PHALU (S-adenosylmethionine synthetase OS=Phaseolus lunatus GN=SAMS PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 6.581e-61
Identity = 113/128 (88.28%), Postives = 120/128 (93.75%), Query Frame = -2
Query:  214 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVAS LA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKE+ DFRPGM++INLDLKRGGN RFLK AAYGHFGR+DPDFTWEVVKPLKWEK
Sbjct:  264 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASELARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKWEK 391          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_BRAJU (S-adenosylmethionine synthetase 2 OS=Brassica juncea GN=MSAMS2 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 6.581e-61
Identity = 116/131 (88.55%), Postives = 121/131 (92.37%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVDSYGTGKIPDKEIL+IVKES DFRPGM++INLDLKRGGNGRFLK AAYGHFGRDD DFTWEVVKPLK  K QA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIVKESFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKSNKVQA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_POPDE (S-adenosylmethionine synthetase OS=Populus deltoides GN=METK PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.123e-60
Identity = 112/127 (88.19%), Postives = 119/127 (93.70%), Query Frame = -2
Query:  217 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWE 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEIL+IVKE  DFRPGM++INLDLKRGGN RFLK AAYGHFGRDDPDFTWEVVKPLKW+
Sbjct:  264 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILQIVKERFDFRPGMISINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWD 390          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_GOSHI (S-adenosylmethionine synthetase OS=Gossypium hirsutum GN=SAMS PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.123e-60
Identity = 112/131 (85.50%), Postives = 120/131 (91.60%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RC+VQVSYAIGVPEPLS+FVD+YGTGKIPDKEILKIVKE+ DFRPGM+ INLDLKRGGN RFLK AAYGHFGRDD DFTWEVVKPLKW+K  A
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCVVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGRDDTDFTWEVVKPLKWDKVHA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_PINBN (S-adenosylmethionine synthetase OS=Pinus banksiana GN=METK PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.915e-60
Identity = 112/131 (85.50%), Postives = 119/131 (90.84%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKSIVA+GLA RCIVQVSYAIGVPEPLSLFVD+YGTG IPDKEIL+I+KE  DFRPGM++INLDLKRGGNGR  K AAYGHFGRDDPDFTWE VKPLKWEK QA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSLFVDTYGTGSIPDKEILEIIKEHFDFRPGMISINLDLKRGGNGRSQKTAAYGHFGRDDPDFTWETVKPLKWEKAQA 393          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.266e-60
Identity = 111/131 (84.73%), Postives = 120/131 (91.60%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYI RQAAKSIVASG+A RCIVQVSYAIGVPEPLS+FVD+YGTGKIPDKEIL+IVKE+ DFRPGM+ INLDLKRGG+GR+LK AAYGHFGRD  DFTWEVVKPLKWEKP A
Sbjct:  266 GAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGIARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILEIVKENFDFRPGMIIINLDLKRGGSGRYLKTAAYGHFGRDGADFTWEVVKPLKWEKPSA 396          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_ORYSJ (S-adenosylmethionine synthetase 2 OS=Oryza sativa subsp. japonica GN=SAM2 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 5.571e-60
Identity = 114/128 (89.06%), Postives = 120/128 (93.75%), Query Frame = -2
Query:  214 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEK 597
            GAHGG AF GKDP KVDR+GAYI RQAAKSIVASGLA RCIVQVSYAIGVPEPLS+FVDSYGTGKIPDKEILKIVKE+ DFRPGMMTINLDLKRGGN RF+K AAYGHFGR+DPDFTWEVVKPLK+EK
Sbjct:  265 GAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFIKTAAYGHFGREDPDFTWEVVKPLKYEK 391          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK3_ORYSJ (S-adenosylmethionine synthetase 3 OS=Oryza sativa subsp. japonica GN=METK3 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 7.276e-60
Identity = 109/131 (83.21%), Postives = 120/131 (91.60%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYI RQAAKSIVA+GLA RCIVQVSYAIGVPEPLS+FVD+YGTGKIPD+EIL+IV E+ DFRPGM+ INLDL RGGNGR+LK AAYGHFGR+DPDFTWEVVKPLKWE+P A
Sbjct:  266 GAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILRIVTENFDFRPGMIIINLDLMRGGNGRYLKTAAYGHFGREDPDFTWEVVKPLKWEEPSA 396          
The following BLAST results are available for this feature:
BLAST of CF834295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_PICSI2.954e-6184.73S-adenosylmethionine synthetase 2 OS=Picea sitchen... [more]
METK2_CATRO5.039e-6187.02S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]
METK_PHALU6.581e-6188.28S-adenosylmethionine synthetase OS=Phaseolus lunat... [more]
METK2_BRAJU6.581e-6188.55S-adenosylmethionine synthetase 2 OS=Brassica junc... [more]
METK_POPDE1.123e-6088.19S-adenosylmethionine synthetase OS=Populus deltoid... [more]
METK_GOSHI1.123e-6085.50S-adenosylmethionine synthetase OS=Gossypium hirsu... [more]
METK_PINBN1.915e-6085.50S-adenosylmethionine synthetase OS=Pinus banksiana... [more]
METK4_HORVU3.266e-6084.73S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]
METK2_ORYSJ5.571e-6089.06S-adenosylmethionine synthetase 2 OS=Oryza sativa ... [more]
METK3_ORYSJ7.276e-6083.21S-adenosylmethionine synthetase 3 OS=Oryza sativa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05E14_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05E14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834295 ID=CF834295; Name=CF834295; organism=Citrus sinensis; type=EST; length=598bp
GGAACATTAAACCAAAACCAAAAAAGACCTCGGGGAAAGAAGAAAAAGAA
AGGAATTGAATGGGGAACATGTATGAGTTCCGAACACAGGAGATTTGCTT
AGTATTACAAAGCAGCAGCAAGATAATATTCAAATTATTCATCCACTACC
AATAGAAGCAAACTTGAACAGGAGGGATAGTTTGCACTTTTCAACTCAAA
TTTAAGCTTGAGGCTTTTCCCACTTGAGGGGCTTCACAACTTCCCAAGTG
AAGTCTGGGTCATCCCTGCCAAAGTGTCCATAGGCAGCAGGCTTCAAGAA
CCTGCCATTACCGCCCCTTTTGAGATCCAAATTGATGGTCATCATTCCTG
GCCTGAAATCAGAGCTTTCCTTCACAATTTTGAGGATCTCCTTGTCAGGA
ATCTTGCCGGTTCCATATGAGTCCACAAAAAGAGACAATGGCTCAGGCAC
ACCTATGGCATACGAGACTTGGACAATGCACCTGGGAGCAAGCCCGCTTG
CAACAATGCTCTTAGCAGCCTGCCTAACAATGTATGCACCAGTCCTATCC
ACCTTAGGAGGGTCTTTTCCAAAGAAAGCACAGCCACCATGGGCTCCC
back to top