CF834295

Overview
NameCF834295
Unique NameCF834295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:1033..1629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK3_SOLLC (S-adenosylmethionine synthetase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.919e-52
Identity = 100/125 (80.00%), Postives = 110/125 (88.00%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RCIVQVSYAIGV EPLS+FVD+Y TG IPDK+IL ++KE+ DFRPGMM+INLDL RGGN R+ K AAYGHFGRDDPDFTWE VK LK
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENFDFRPGMMSINLDLLRGGNYRYQKTAAYGHFGRDDPDFTWETVKVLK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_SOLTU (S-adenosylmethionine synthetase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.919e-52
Identity = 100/125 (80.00%), Postives = 110/125 (88.00%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RCIVQVSYAIGV EPLS+FVD+Y TG IPDK+IL ++KE+ DFRPGMM+INLDL RGGN R+ K AAYGHFGRDDPDFTWE VK LK
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENFDFRPGMMSINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_PETHY (S-adenosylmethionine synthetase 1 OS=Petunia hybrida GN=SAM1 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.274e-52
Identity = 102/131 (77.86%), Postives = 112/131 (85.50%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RCIVQVSYAIGV EPLS+FVD+Y TG IPDK+IL ++KE+ DFRPGMM+INLDL RGGN R+ K AAYGHFGRDDPDFTWE VK L    PQA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILTLIKENFDFRPGMMSINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKVL---NPQA 390          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_TOBAC (S-adenosylmethionine synthetase 1 OS=Nicotiana tabacum GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.276e-52
Identity = 99/125 (79.20%), Postives = 110/125 (88.00%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RCIVQVSYAIGV EPLS+FVD+Y TG IPDK+IL ++KE+ DFRPGMM+INLDL RGGN R+ K AAYGHFGRDDPDF+WE VK LK
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILTLIKENFDFRPGMMSINLDLLRGGNFRYQKTAAYGHFGRDDPDFSWETVKVLK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK1_ACTCH (S-adenosylmethionine synthetase 1 OS=Actinidia chinensis GN=SAM1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.276e-52
Identity = 99/125 (79.20%), Postives = 110/125 (88.00%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RC+VQVSYAIGV EPLS+FVD+Y TGKI DK+IL ++KE+ DFRPGM+ INLDLKRGGN R+ K AAYGHFGRDDPDFTWE VK LK
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVAEPLSVFVDTYKTGKIADKDILALIKENFDFRPGMIAINLDLKRGGNLRYQKTAAYGHFGRDDPDFTWETVKILK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_PETHY (S-adenosylmethionine synthetase 2 OS=Petunia hybrida GN=SAM2 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.771e-51
Identity = 100/131 (76.34%), Postives = 111/131 (84.73%), Query Frame = -2
Query:  205 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLKWEKPQA 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RCIVQVSYAIGV EPLS+FVD+Y TG IP K++L ++KE+ DFRPGMM+INLDL RGGN R+ K AAYGHFGRDDPDFTWE VK L    PQA
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPGKDVLTLIKENFDFRPGMMSINLDLLRGGNFRYQKTAAYGHFGRDDPDFTWETVKVL---NPQA 390          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK3_CATRO (S-adenosylmethionine synthetase 3 OS=Catharanthus roseus GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 4.727e-51
Identity = 97/125 (77.60%), Postives = 109/125 (87.20%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYIVRQAAKS+VASGLA RC+VQVSYAIGV EPLS+FVD++ TGKIPDK+IL ++KE+ DFRPGM+ INLDLKRGGN R+ K AA GH GRDDPDFTWE VK LK
Sbjct:  263 GAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVAEPLSVFVDTFKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAALGHLGRDDPDFTWETVKILK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_CHLRE (S-adenosylmethionine synthetase OS=Chlamydomonas reinhardtii GN=METM PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.986e-49
Identity = 92/125 (73.60%), Postives = 107/125 (85.60%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHGG AF GKDP KVDR+GAYI RQAAKS+VASGLA RC+VQVSY+I V EPLS+FVD+YGTG +PD EILK++++  DFRPG++  NLDLKRGGN R+ K AAYGHFGRDDPDFTWE VK L+
Sbjct:  266 GAHGGGAFSGKDPTKVDRSGAYIARQAAKSVVASGLAKRCLVQVSYSIAVAEPLSVFVDTYGTGTMPDAEILKLIRKHFDFRPGLIGKNLDLKRGGNKRYQKTAAYGHFGRDDPDFTWETVKKLE 390          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK2_TOBAC (S-adenosylmethionine synthetase 2 OS=Nicotiana tabacum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.986e-49
Identity = 95/125 (76.00%), Postives = 107/125 (85.60%), Query Frame = -2
Query:  223 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDDPDFTWEVVKPLK 597
            GAHG  AF GKDP KVDR+GAYIVRQAAKS+VA+GLA RCIVQVSYAIGV EPLS+FVD+Y TG IPDK+IL ++KE+ DFRPGM+ INLDL RGGN R+ K AAYGHFGRD+ DFTWE VK LK
Sbjct:  263 GAHGEGAFSGKDPTKVDRSGAYIVRQAAKSVVAAGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILALIKENFDFRPGMIAINLDLLRGGNFRYQKTAAYGHFGRDEADFTWETVKALK 387          
BLAST of CF834295 vs. ExPASy Swiss-Prot
Match: METK_OSTLU (S-adenosylmethionine synthetase OS=Ostreococcus lucimarinus (strain CCE9901) GN=METK-1 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.247e-43
Identity = 90/126 (71.43%), Postives = 100/126 (79.37%), Query Frame = -2
Query:  226 GAHGGCAFFGKDPPKVDRTGAYIVRQAAKSIVASGLAPRCIVQVSYAIGVPEPLSLFVDSYGTGKIPDKEILKIVKESSDFRPGMMTINLDLKRGGNGRFLKPAAYGHFGRDD--PDFTWEVVKPL 597
            GAHGG AF GKDP KVDR+GAYI RQAAKS+VA+GLA RC+ Q+SYAIGV EPLS+ VD+YGTGKIPD EIL  VK + DFRPGMM   LDLKRGGN R+   AAYGHFGRD+    FTWE V PL
Sbjct:  262 GAHGGGAFSGKDPTKVDRSGAYISRQAAKSVVAAGLARRCLFQISYAIGVAEPLSVHVDTYGTGKIPDSEILAKVKAAFDFRPGMMGKALDLKRGGNKRYQTTAAYGHFGRDEDLDIFTWEKVVPL 387          
The following BLAST results are available for this feature:
BLAST of CF834295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_SOLLC1.919e-5280.00S-adenosylmethionine synthetase 3 OS=Solanum lycop... [more]
METK2_SOLTU1.919e-5280.00S-adenosylmethionine synthetase 2 OS=Solanum tuber... [more]
METK1_PETHY3.274e-5277.86S-adenosylmethionine synthetase 1 OS=Petunia hybri... [more]
METK1_TOBAC4.276e-5279.20S-adenosylmethionine synthetase 1 OS=Nicotiana tab... [more]
METK1_ACTCH4.276e-5279.20S-adenosylmethionine synthetase 1 OS=Actinidia chi... [more]
METK2_PETHY2.771e-5176.34S-adenosylmethionine synthetase 2 OS=Petunia hybri... [more]
METK3_CATRO4.727e-5177.60S-adenosylmethionine synthetase 3 OS=Catharanthus ... [more]
METK_CHLRE1.986e-4973.60S-adenosylmethionine synthetase OS=Chlamydomonas r... [more]
METK2_TOBAC1.986e-4976.00S-adenosylmethionine synthetase 2 OS=Nicotiana tab... [more]
METK_OSTLU1.247e-4371.43S-adenosylmethionine synthetase OS=Ostreococcus lu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_05E14_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa05E14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834295 ID=CF834295; Name=CF834295; organism=Citrus sinensis; type=EST; length=598bp
GGAACATTAAACCAAAACCAAAAAAGACCTCGGGGAAAGAAGAAAAAGAA
AGGAATTGAATGGGGAACATGTATGAGTTCCGAACACAGGAGATTTGCTT
AGTATTACAAAGCAGCAGCAAGATAATATTCAAATTATTCATCCACTACC
AATAGAAGCAAACTTGAACAGGAGGGATAGTTTGCACTTTTCAACTCAAA
TTTAAGCTTGAGGCTTTTCCCACTTGAGGGGCTTCACAACTTCCCAAGTG
AAGTCTGGGTCATCCCTGCCAAAGTGTCCATAGGCAGCAGGCTTCAAGAA
CCTGCCATTACCGCCCCTTTTGAGATCCAAATTGATGGTCATCATTCCTG
GCCTGAAATCAGAGCTTTCCTTCACAATTTTGAGGATCTCCTTGTCAGGA
ATCTTGCCGGTTCCATATGAGTCCACAAAAAGAGACAATGGCTCAGGCAC
ACCTATGGCATACGAGACTTGGACAATGCACCTGGGAGCAAGCCCGCTTG
CAACAATGCTCTTAGCAGCCTGCCTAACAATGTATGCACCAGTCCTATCC
ACCTTAGGAGGGTCTTTTCCAAAGAAAGCACAGCCACCATGGGCTCCC
back to top