CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSI (Chalcone synthase OS=Oryza sativa subsp. indica GN=CHS PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 3.735e-102
Identity = 183/234 (78.21%), Postives = 202/234 (86.32%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVL VCSEITAVTFRGP+++HLDS+VGQALF           DPD +VERPL+Q+VS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L +AF P+GISDWNSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+  ATTGEG+DWGVLFGFGPGLTVETVVLHSVPI A
Sbjct:  161 MMYQQGCFAGGTVLRVAKDLAENNRGARVLAVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGSDPDEAVERPLFQMVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALGDAFTPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPITA 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_MATIN (Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 6.372e-102
Identity = 187/233 (80.26%), Postives = 202/233 (86.70%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDTSV E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKSA++  ATTGEGL+WGVLFGFGPGLTVETVVL SVP+
Sbjct:  162 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAQDGVATTGEGLEWGVLFGFGPGLTVETVVLRSVPL 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_CARAN (Chalcone synthase OS=Cardamine amara GN=CHS PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 6.372e-102
Identity = 186/233 (79.83%), Postives = 202/233 (86.70%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDTSV E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR V+ EYGNMSSACVLFILDEMRKKSA++  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  163 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 6.372e-102
Identity = 185/232 (79.74%), Postives = 202/232 (87.07%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEGLDWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_SINAL (Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 8.322e-102
Identity = 186/233 (79.83%), Postives = 201/233 (86.27%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDTSV E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMR+KS E+  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  163 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAIIVGSDPDTSVGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 1.087e-101
Identity = 186/234 (79.49%), Postives = 198/234 (84.62%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN G+RVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDT +E PL++LVS +QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKS EE K +TGEGL+WGVLFGFGPGLTVETVVLHSV   A
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIELPLFELVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEWGVLFGFGPGLTVETVVLHSVSAPA 391          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 1.087e-101
Identity = 184/232 (79.31%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DPD  VERPL+QLVS +QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNI ++L +AF P+GISDWNSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEGLDWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVVVGADPDDRVERPLFQLVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIGRALDDAFKPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.419e-101
Identity = 186/232 (80.17%), Postives = 200/232 (86.21%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQV-XXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCF GGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDT++ERPL++LVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GI+DWNSIFWIAHPGGPAILDQV            +ATR +LSEYGNMSSACVLFILDEMRKKSA   +ATTG+GL+WGVLFGFGPGLTVETVVLHSVP
Sbjct:  161 MMYQQGCFPGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPDTAIERPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFKPIGINDWNSIFWIAHPGGPAILDQVEHKLAPGRRANSRATRHILSEYGNMSSACVLFILDEMRKKSARRREATTGDGLEWGVLFGFGPGLTVETVVLHSVP 392          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.419e-101
Identity = 185/232 (79.74%), Postives = 198/232 (85.34%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN GARVLVVCSEITAVTFRGPADTHLDSLVGQALF           DP   VERPL+Q+V+ +QT+LPDS GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           ++TRQVLSEYGNMSSACVLFILDEMRK SA+E  +TTGEGLDWGVLFGFGPGLTVETVVLHSVP+
Sbjct:  158 MMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIVTAAQTLLPDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSVFWIAHPGGPAILDQVEEKLGLKPEKLRSTRQVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTGEGLDWGVLFGFGPGLTVETVVLHSVPL 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_SORBI (Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=3 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.854e-101
Identity = 184/232 (79.31%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEG DWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHSY_ORYSI3.735e-10278.21Chalcone synthase OS=Oryza sativa subsp. indica GN... [more]
CHSY_MATIN6.372e-10280.26Chalcone synthase OS=Matthiola incana GN=CHS PE=2 ... [more]
CHSY_CARAN6.372e-10279.83Chalcone synthase OS=Cardamine amara GN=CHS PE=3 S... [more]
CHS4_SORBI6.372e-10279.74Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHS3_SINAL8.322e-10279.83Chalcone synthase 3 OS=Sinapis alba GN=CHS3 PE=2 S... [more]
CHSY_VITVI1.087e-10179.49Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHS2_MAIZE1.087e-10179.31Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHSY_CHRAE1.419e-10180.17Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHSY_ANTMA1.419e-10179.74Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3... [more]
CHS6_SORBI1.854e-10179.31Chalcone synthase 6 OS=Sorghum bicolor GN=CHS6 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top