CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSB_IPOCO (Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 7.632e-55
Identity = 108/199 (54.27%), Postives = 138/199 (69.35%), Query Frame = -2
Query:  252 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEE 848
            MMY QGC AG  +LRLAKD+AENNKGARVLVVCSE+    FRGP+    D+L+ Q LF           DP   +E PL++L+S +QTI+P++D  +  H+RE+GLTFH  K VP  I++N+E  L +AF P GISDWNSIFW+ HPGG AI+D V           +A+R VLS YGN++SACVLFILDE+RKKS ++
Sbjct:  164 MMYQQGCNAGAAMLRLAKDVAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAALIVGTDPRPGLETPLFELISAAQTIIPNTDSHLKLHVREMGLTFHCSKAVPTFITQNVEDCLVKAFEPYGISDWNSIFWVLHPGGNAIVDGVEETLGLAPEKLRASRDVLSGYGNLTSACVLFILDEVRKKSKKD 362          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSB_IPOTR (Chalcone synthase B (Fragment) OS=Ipomoea triloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.438e-54
Identity = 107/196 (54.59%), Postives = 138/196 (70.41%), Query Frame = -2
Query:  261 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKS 848
            MMY QGC AG  +LRLAKDLAE+NKG R+LVVCSEIT   FRGP+    D+L+ Q LF           DP   +E PL++LVS++QTI+P++D  +   LRE+GLTFH  + VP ++++N+E  L +AF P GISDWNSIFW+ HPGG AI+D+V           +A+R VLSEYGN++SACVLFILDE+R KS
Sbjct:  166 MMYQQGCNAGAAMLRLAKDLAESNKGGRILVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGTDPRPDLETPLFELVSSAQTIVPNTDSHLKLTLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGISDWNSIFWVFHPGGNAIVDRVEERLGLGAQRFRASRDVLSEYGNLTSACVLFILDEVRNKS 361          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSC_IPOPU (Chalcone synthase C (Fragment) OS=Ipomoea purpurea GN=CHSC PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 3.001e-51
Identity = 104/187 (55.61%), Postives = 126/187 (67.38%), Query Frame = -2
Query:  288 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLF 848
            MMY QGC AG  +LRLAKDLAENNKG RVLVVCSE+    FRGP+    D+L+ Q LF           +P   +E PL++LVS +QT +PD+D  +   LRE+GLTFH  K VP LI++NIE  L +AF P GISDWNSIFWI HPGG AILD V           +A+R VLS+YGN++SACVLF
Sbjct:  164 MMYQQGCNAGAVMLRLAKDLAENNKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLF 350          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSA_IPONI (Chalcone synthase A (Fragment) OS=Ipomoea nil GN=CHSA PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.151e-49
Identity = 101/184 (54.89%), Postives = 123/184 (66.85%), Query Frame = -2
Query:  297 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSAC 848
            MMY QGC AG  +LRLAKDLAENNKG RVLVVCSE+    FRGP+    D L+ Q LF           +P   +E PL++LVS +QT +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG AILD+V           +A+R VLSE GN++SAC
Sbjct:  161 MMYQQGCNAGAAMLRLAKDLAENNKGGRVLVVCSEVMLNVFRGPSLEQEDYLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDYLVKAFEPFGISDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASRDVLSESGNLTSAC 344          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_FRAAN (Chalcone synthase RJ5 (Fragment) OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 7.935e-36
Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = -2
Query:  159 ISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 446
            I+DWNS+FWIAHPGGPAILDQV           +ATR +LSEYGNMSSACVLFILDE+R+KSA     TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:    2 ITDWNSLFWIAHPGGPAILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWGVLFGFGPGLTVETVVLHSV 97          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: PKS1_DICDI (Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.536e-14
Identity = 62/230 (26.96%), Postives = 99/230 (43.04%), Query Frame = -2
Query:  159 GCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIF-----WIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 833
            GC AG + LR A  LA+ +   R+LVVC+E+ ++ F        D +V  ++F           +P    E PLY+++ +     P+++ A+   L + G    L   +P +I   IE  +        +    +I      ++ H GG +IL  +           K T  V   YGNMSSA V+F++D  RK  +            + +   FGPGL  E   L +V
Sbjct: 2929 GCLAGLSSLRTAASLAKASPRNRILVVCTEVCSLHFSNTDGG--DQMVASSIFADGSAAYIIGCNPRIE-ETPLYEVMCSINRSFPNTENAMVWDLEKEGWNLGLDASIPIVIGSGIEAFVDTLLDKAKLQTSTAISAKDCEFLIHTGGKSILMNIENSLGIDPKQTKNTWDVYHAYGNMSSASVIFVMDHARKSKSLPT---------YSISLAFGPGLAFEGCFLKNV 3146          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: PKS37_DICDI (Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.990e-12
Identity = 52/226 (23.01%), Postives = 98/226 (43.36%), Query Frame = -2
Query:  171 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVV 848
            M+   GC A    +R A   A+   G  VLVV  E +A   +   D+  D L+ QA+F            P +S+   L +++     ++PDS  A++  +   G+   L  ++P  I+++I  +++       +   +  F+  HPGG  I+  V             + +V+  YGNM      ++L  +  K+ +        G ++G+   F PG ++E ++
Sbjct: 2741 MINFMGCGAAVNSMRAATAYAKLKPGTFVLVVAVEASATCMKFNFDSRSD-LLSQAIFTDGCVATLVTCQPKSSLVGKL-EIIDDLSYLMPDSRDALNLFIGPTGIDLDLRPELPIAINRHINSAITSWLKKNSLQKSDIEFFATHPGGAKIISAVHEGLGLSPEDLSDSYEVMKRYGNMIGVSTYYVLRRILDKN-QTLLQEGSLGYNYGMAMAFSPGASIEAIL 2963          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHSB_IPOCO7.632e-5554.27Chalcone synthase B (Fragment) OS=Ipomoea cordatot... [more]
CHSB_IPOTR8.438e-5454.59Chalcone synthase B (Fragment) OS=Ipomoea triloba ... [more]
CHSC_IPOPU3.001e-5155.61Chalcone synthase C (Fragment) OS=Ipomoea purpurea... [more]
CHSA_IPONI2.151e-4954.89Chalcone synthase A (Fragment) OS=Ipomoea nil GN=C... [more]
CHSY_FRAAN7.935e-3675.00Chalcone synthase RJ5 (Fragment) OS=Fragaria anana... [more]
PKS1_DICDI6.536e-1426.96Probable polyketide synthase 1 OS=Dictyostelium di... [more]
PKS37_DICDI7.990e-1223.01Probable polyketide synthase 37 OS=Dictyostelium d... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top