CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS5_SORBI (Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=3 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.854e-101
Identity = 184/232 (79.31%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEG DWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_SORBI (Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=3 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.854e-101
Identity = 184/232 (79.31%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEG DWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERLRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 2.421e-101
Identity = 185/233 (79.40%), Postives = 202/233 (86.70%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPDTSV E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNI KSL EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMR+KSA++  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  163 MMYQQGCFAGGTVLRIAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIVKSLDEAFKPLGISDWNSLFWIAHPGGPAILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPL 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_SECCE (Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 2.421e-101
Identity = 182/234 (77.78%), Postives = 199/234 (85.04%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP ++HLDSLVGQALF           DPD S+ERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L +AF P+GI DWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFI+DEMRK+SAE+   TTGEG+DWGVLFGFGPGLTVETVVLHSVP+ A
Sbjct:  161 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADPDESIERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEDAFKPLGIDDWNSVFWIAHPGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHTTTGEGMDWGVLFGFGPGLTVETVVLHSVPVTA 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_SORBI (Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=3 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 4.130e-101
Identity = 183/232 (78.88%), Postives = 201/232 (86.64%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ +ATTGEG +WGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGRATTGEGFEWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_GERHY (Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=2 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 5.394e-101
Identity = 183/231 (79.22%), Postives = 198/231 (85.71%), Query Frame = -2
Query:  156 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVP 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DPD + ERPL+++VS +QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L+ AF+P+GI+DWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFI+DEMRKKS+E    TTGEGL+WGVLFGFGPGLTVETVVLHSVP
Sbjct:  161 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPDLTTERPLFEMVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTTAFSPLGINDWNSIFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFIIDEMRKKSSENGAGTTGEGLEWGVLFGFGPGLTVETVVLHSVP 391          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 7.045e-101
Identity = 184/232 (79.31%), Postives = 197/232 (84.91%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN GARVLVVCSEITAVTFRGP+++HLDSLVGQALF           DP   VERPL+QLVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV           ++TR VL EYGNMSSACVLFILDEMRK SA+E  ++TGEGLDWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  158 MMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGPAILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSSTGEGLDWGVLFGFGPGLTVETVVLHSVPI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS7_SORBI (Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 7.045e-101
Identity = 184/232 (79.31%), Postives = 200/232 (86.21%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VE PL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE+SL EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAEE +ATTGEG DWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDKRVECPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEEGQATTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 9.200e-101
Identity = 184/234 (78.63%), Postives = 198/234 (84.62%), Query Frame = -2
Query:  147 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIKA 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP ++HLDSLVGQALF           DPD SVERPL+QLVS SQTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L EAF P+GI  WNS+FWIAH GGPAILD V           +ATR VLSEYGNMSSACVLFI+DEMRK+SAE+  ATTGEG+DWGVLFGFGPGLTVETVVLHSVPI A
Sbjct:  161 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADPDLSVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEEAFKPLGIDHWNSVFWIAHQGGPAILDMVEAKVNLNKERMRATRHVLSEYGNMSSACVLFIMDEMRKRSAEDGHATTGEGMDWGVLFGFGPGLTVETVVLHSVPISA 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.202e-100
Identity = 185/230 (80.43%), Postives = 197/230 (85.65%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL++LVS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL+EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKSA +   TTGEGL+WGVLFGFGPGLTVETVVLHS+
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEWGVLFGFGPGLTVETVVLHSL 387          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS5_SORBI1.854e-10179.31Chalcone synthase 5 OS=Sorghum bicolor GN=CHS5 PE=... [more]
CHS3_SORBI1.854e-10179.31Chalcone synthase 3 OS=Sorghum bicolor GN=CHS3 PE=... [more]
CHSY_ARATH2.421e-10179.40Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS2_SECCE2.421e-10177.78Chalcone synthase 2 OS=Secale cereale GN=CHS2 PE=2... [more]
CHS2_SORBI4.130e-10178.88Chalcone synthase 2 OS=Sorghum bicolor GN=CHS2 PE=... [more]
CHS1_GERHY5.394e-10179.22Chalcone synthase 1 OS=Gerbera hybrida GN=CHS1 PE=... [more]
CHSY_PERFR7.045e-10179.31Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHS7_SORBI7.045e-10179.31Chalcone synthase 7 OS=Sorghum bicolor GN=CHS7 PE=... [more]
CHS1_HORVU9.200e-10178.63Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHS1_CAMSI1.202e-10080.43Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top