CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.050e-100
Identity = 183/230 (79.57%), Postives = 198/230 (86.09%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL++LVS +QT+LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL+EA  P+GISDWNS+FWIAHPGGPAILDQV           +ATRQVLS+YGNMSSACVLFILDE+R+KSAE+   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:    1 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTVLPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEALKPIGISDWNSLFWIAHPGGPAILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLETTGEGLEWGVLFGFGPGLTVETVVLHSV 230          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 2.050e-100
Identity = 184/230 (80.00%), Postives = 198/230 (86.09%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTV+RLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDS+VGQALF           DP   VERPL++LVS +QT+LPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATRQVLS+YGNMSSACVLFILDEMRK S++E  +TTGEGLDWGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELVSAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDWGVLFGFGPGLTVETVVLHSV 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.050e-100
Identity = 183/230 (79.57%), Postives = 197/230 (85.65%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   +E+P+++LVST+QTILPDSDG+IDGHLRE GLTFHLLKDVPGLISKNI+KSL+EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRKKSAE+   T GEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  157 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTILPDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGPAILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEWGVLFGFGPGLTVETVVLHSV 386          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.050e-100
Identity = 184/230 (80.00%), Postives = 197/230 (85.65%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL+++VST+QTILPDSDGAIDGHLREVG+TFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILDQV            ATR VLSEYGNMSSACVLFILDEMR+KSAE+   TTGEGLDWGVLFGFGPGLTVETVVLHS+
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPLFEVVSTAQTILPDSDGAIDGHLREVGVTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPAILDQVEEKLALKPEKLGATRHVLSEYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLDWGVLFGFGPGLTVETVVLHSL 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 3.496e-100
Identity = 182/233 (78.11%), Postives = 199/233 (85.41%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DPD S  E+P++++VS +QTILPDSDGAIDGHLREVG+TFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMR+KS ++  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  162 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDVSAGEKPIFEMVSAAQTILPDSDGAIDGHLREVGITFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSLDDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 394          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 3.496e-100
Identity = 183/232 (78.88%), Postives = 197/232 (84.91%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VE+PL++LVS +QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKN+EKSL+EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMR+KS E+   TTGEG++WGVLFGFGPGLTVETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGPAILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEWGVLFGFGPGLTVETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_SORBI (Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 5.964e-100
Identity = 181/232 (78.02%), Postives = 199/232 (85.78%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+++HLDS+VGQALF           DPD  VERPL+QLVS SQ ILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIE++L EAF P+GI+D+NSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+SAE+ + TTGEG DWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  162 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQRILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERALEEAFKPLGITDYNSIFWVAHPGGPAILDQVEAKVGLEKERMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGQTTTGEGFDWGVLFGFGPGLTVETVVLHSVPI 393          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 5.964e-100
Identity = 179/232 (77.16%), Postives = 200/232 (86.21%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLR+AKD+AENN+GARV+VVCSEITAVTFRGP+++H+DSLVGQALF           DPD  VERPL+QLVS +QTILPDS+GAIDGHLREVGL FHLLKDVPGLISKNIE++L +AF P+GISDWNSIFW+AHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK+ AE+ ++TTGEGLDWGVLFGFGPGLTVETVVLHSVPI
Sbjct:  161 MMYQQGCFAGGTVLRVAKDVAENNRGARVMVVCSEITAVTFRGPSESHVDSLVGQALFGDGAAAGRGGADPDGRVERPLFQLVSAAQTILPDSEGAIDGHLREVGLAFHLLKDVPGLISKNIERALEDAFEPLGISDWNSIFWVAHPGGPAILDQVEAKVGLDKARMRATRHVLSEYGNMSSACVLFILDEMRKRPAEDGQSTTGEGLDWGVLFGFGPGLTVETVVLHSVPI 392          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 7.789e-100
Identity = 183/233 (78.54%), Postives = 198/233 (84.98%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSV-ERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           D D S  E+P++++VS +QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF P+GISDWNS+FWIAHPGGPAILD V           +ATR VLSEYGNMSSACVLFILDEMR+KS E+  ATTGEGL+WGVLFGFGPGLTVETVVLHSVP+
Sbjct:  163 MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDADISAGEKPIFEMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGPAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSVEDGVATTGEGLEWGVLFGFGPGLTVETVVLHSVPV 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSJ_PETHY (Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=2 SV=2)

HSP 1 Score: 363.229 bits (931), Expect = 1.017e-99
Identity = 185/230 (80.43%), Postives = 195/230 (84.78%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VERPL++LVS SQT+LPDS+GAIDGHLREVGLTFHLLKDVPGLISKNI+KSL EAF P+GISDWNSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S++E   TTGEGL+WGVLFGFGPGLTVETVVLHSV
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPLPGVERPLFELVSASQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKSLVEAFQPLGISDWNSIFWIAHPGGPAILDQVELKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLGTTGEGLEWGVLFGFGPGLTVETVVLHSV 387          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHSY_MALDO2.050e-10079.57Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
CHS2_SOLLC2.050e-10080.00Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]
CHS1_CITSI2.050e-10079.57Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHS1_CASGL2.050e-10080.00Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSY_RAPSA3.496e-10078.11Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHSY_HYPAN3.496e-10078.88Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]
CHS1_SORBI5.964e-10078.02Chalcone synthase 1 OS=Sorghum bicolor GN=CHS1 PE=... [more]
CHS1_MAIZE5.964e-10077.16Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHS1_SINAL7.789e-10078.54Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]
CHSJ_PETHY1.017e-9980.43Chalcone synthase J OS=Petunia hybrida GN=CHSJ PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top