CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_TRISU (Chalcone synthase 2 OS=Trifolium subterraneum GN=CHS2 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.063e-96
Identity = 175/232 (75.43%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.063e-96
Identity = 175/232 (75.43%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR VLSEYGNMSSACVLFILDEMRKKSA++   TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEQKLSLKPEKMKATRDVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS6_PEA (Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 4.000e-96
Identity = 175/232 (75.43%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI K+L EAF P+ I D+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA++   TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPLPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNINKALVEAFQPLNIDDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQQGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSA_PEA (Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.224e-96
Identity = 177/230 (76.96%), Postives = 194/230 (84.35%), Query Frame = -2
Query:  159 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSV 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVGQALF           DP   VE+PL++LV T+QTI+PDS+GAIDGHLRE GLTFHLLKDVP L+SKNIEK+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMR+KS E+  ATTGEGL+WGVLFGFGPGLTVETV+LHS+
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPDVEKPLFELVWTAQTIVPDSEGAIDGHLREAGLTFHLLKDVPSLVSKNIEKALVEAFQPLNISDYNSIFWIAHPGGPAILDQVEAKLGLKQRKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLATTGEGLEWGVLFGFGPGLTVETVLLHSM 387          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.224e-96
Identity = 175/232 (75.43%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA++   TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:   34 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNINKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVTI 265          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.224e-96
Identity = 175/232 (75.43%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA++   TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNINKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.224e-96
Identity = 173/232 (74.57%), Postives = 196/232 (84.48%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR+VLSEYGNMSSACVLFILD+MRKKS ++   TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREQGLTFHLLKDVPGIVSKNIDKALVEAFKPLGISDYNSIFWIAHPGGPAILDQVEQKLGLKPEKMRATREVLSEYGNMSSACVLFILDQMRKKSTQDGLNTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.224e-96
Identity = 173/232 (74.57%), Postives = 196/232 (84.48%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           +ATR+VLSEYGNMSSACVLFILDEMR+KSA++   TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALIEAFQPLNISDYNSIFWIAHPGGPAILDQVEEKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRRKSAKDGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 8.911e-96
Identity = 173/232 (74.57%), Postives = 195/232 (84.05%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR+VLSEYGNMSSACVLFILDEMRKKS ++   TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSTQDGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 1.164e-95
Identity = 175/232 (75.43%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHL E GLTFHLLKDVPG++SKNI+K+L EAF P+ ISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGLDWGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLVEAGLTFHLLKDVPGIVSKNIDKALIEAFQPLNISDYNSIFWIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEMRKKSAQAGLKTTGEGLDWGVLFGFGPGLTIETVVLHSVAI 389          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS2_TRISU3.063e-9675.43Chalcone synthase 2 OS=Trifolium subterraneum GN=C... [more]
CHS1_TRISU3.063e-9675.43Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHS6_PEA4.000e-9675.43Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 ... [more]
CHSA_PEA5.224e-9676.96Chalcone synthase 1A OS=Pisum sativum GN=CHS-1A PE... [more]
CHS7_MEDSA5.224e-9675.43Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]
CHS5_MEDSA5.224e-9675.43Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHS1_PEA5.224e-9674.57Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHS1_CICAR5.224e-9674.57Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=... [more]
CHS4_MEDSA8.911e-9674.57Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]
CHS3_MEDSA1.164e-9575.43Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top