CF835317

Overview
NameCF835317
Unique NameCF835317
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length849
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9291 contig Csv1_Contig9291:524..1372. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 1.164e-95
Identity = 183/232 (78.88%), Postives = 193/232 (83.19%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVGQALF           DP   VE+PL+QLV T+QTILPDS+GAIDGHLREVGLTFHLLKDVPGLISKNIEK+L EAF P+GISD+NSIF IAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILD+MRKKS E    TTGEGLDWGVLFGFGPGLTVETVVL SV +
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDP-LPVEKPLFQLVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFRIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWGVLFGFGPGLTVETVVLRSVTV 388          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_ONOVI (Chalcone synthase OS=Onobrychis viciifolia GN=CHS PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.520e-95
Identity = 173/227 (76.21%), Postives = 193/227 (85.02%), Query Frame = -2
Query:  168 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVL 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+PL++L+ T+QTI PDS+GAIDGHLREVGLTFHLLKDVPG++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           +ATR+VLSEYGNMSSACVLFILDEMRKKSA+    TTGEGL+WGVLFGFGPGLT+ETVVL
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPLFELIWTAQTIAPDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLAFKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLEWGVLFGFGPGLTIETVVL 384          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.520e-95
Identity = 170/232 (73.28%), Postives = 190/232 (81.90%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            M+Y QGCFAGGTVLRLAKDLAENNKGARVLVVCSEITA+ FRGP +  LDS+VGQALF           DPD S+ERPL+Q+    QT+LPDS+GAIDGHLREVGLTFHLLKDVPG+ISKNI  +L EAF+P+G+SDWN++FWIAHPGGPAILDQV            ATR VLS++GNMSSACVLFILDEMRKKS  +   TTGEGLDWGVLFGFGPGLTVETVVLHSVP+
Sbjct:  158 MLYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGALIVGSDPDLSIERPLFQMAWAGQTLLPDSEGAIDGHLREVGLTFHLLKDVPGIISKNITNALEEAFSPIGVSDWNNLFWIAHPGGPAILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWGVLFGFGPGLTVETVVLHSVPL 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.985e-95
Identity = 176/233 (75.54%), Postives = 191/233 (81.97%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +QT+ PDS GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSVPIK
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.985e-95
Identity = 176/233 (75.54%), Postives = 191/233 (81.97%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQALF           DP T  E+PL+QLVS +QT+ PDS GAIDGHLREVGLTFHLLKDVP ++S NIEK L EAF P+GISDWNS+FWIAHPGGPAILDQV           +ATR VLSEYGNMSSACVLFILDEMRK S+     TTGEGL+WGVLFGFGPGLT+ETVVLHSVPIK
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADP-TPAEKPLFQLVSAAQTLAPDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPAILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWGVLFGFGPGLTIETVVLHSVPIK 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS5_PEA (Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 2.593e-95
Identity = 173/232 (74.57%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVP ++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMR+KS +    TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS2_MEDSA (Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 3.386e-95
Identity = 173/232 (74.57%), Postives = 192/232 (82.76%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVPG++SKNI K+L EAF P+GISD+NSIFWIAHPGGPAILDQV            ATR+VLSEYGNMSSACVLFILDEMRKKS +    TTGEGL+WGVLFGFGPGLT+ETVVL SV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMNATREVLSEYGNMSSACVLFILDEMRKKSTQNGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.423e-95
Identity = 178/233 (76.39%), Postives = 193/233 (82.83%), Query Frame = -2
Query:  150 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPIK 848
            MMY QGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDS+VGQALF           DP   VE+P ++L+ T+QTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSL EAF   GISDWN +FWIAHPGGPAILDQV           +ATRQVLSEYGNMSSACV FILDEMRK S E+  +TTGEGLD GVLFGFGPGLTVETVVL SVP++
Sbjct:  163 MMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAALIVGADPIPQVEKPCFELMWTAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQQFGISDWNQLFWIAHPGGPAILDQVEAKLNLDPKKLRATRQVLSEYGNMSSACVHFILDEMRKSSNEKGCSTTGEGLDVGVLFGFGPGLTVETVVLKSVPLQ 395          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.423e-95
Identity = 173/232 (74.57%), Postives = 194/232 (83.62%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E+P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVP ++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMR+KS +    TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPLPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVVI 389          
BLAST of CF835317 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 5.776e-95
Identity = 173/232 (74.57%), Postives = 193/232 (83.19%), Query Frame = -2
Query:  153 MMYXQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXDPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAILDQVXXXXXXXXXXXKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGVLFGFGPGLTVETVVLHSVPI 848
            MMY QGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQALF           DP   +E P++++V T+QTI PDS+GAIDGHLRE GLTFHLLKDVP ++SKNI+K+L EAF P+GISD+NSIFWIAHPGGPAILDQV           KATR+VLSEYGNMSSACVLFILDEMR+KS +    TTGEGL+WGVLFGFGPGLT+ETVVLHSV I
Sbjct:  158 MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPLPEIENPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPAIVSKNIDKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVEQKLALKPEKMKATREVLSEYGNMSSACVLFILDEMRRKSIQNGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAI 389          
The following BLAST results are available for this feature:
BLAST of CF835317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
CHS2_SOYBN1.164e-9578.88Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHSY_ONOVI1.520e-9576.21Chalcone synthase OS=Onobrychis viciifolia GN=CHS ... [more]
CHSY_DIAMO1.520e-9573.28Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS7_IPOBA1.985e-9575.54Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]
CHS2_IPOBA1.985e-9575.54Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS5_PEA2.593e-9574.57Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 ... [more]
CHS2_MEDSA3.386e-9574.57Chalcone synthase 2 OS=Medicago sativa GN=CHS2 PE=... [more]
CHS7_PICMA4.423e-9576.39Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 ... [more]
CHS4_PEA4.423e-9574.57Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS3_PEA5.776e-9574.57Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01A15_r Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01A15, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835317 ID=CF835317|Name=CF835317|organism=Citrus sinensis|type=EST|length=849bp
TTTTGACGTCATCAGTGAAAAGGTACGATGCCTTAAATTCAATTGACAAA
ACTAAACCTTCACACGATCAACCAATAATTCAAGAGTGAAAGCATACAAC
ATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCT
TTGATGGGGACACTGTGCAGCACAACGGTCTCGACGGTGAGCCCCGGCCC
GAACCCGAACAGCACACCCCAATCTAGCCCTTCGCCGGTGGTGGCTTTCG
CTTCCTCAGCAGACTTCTTTCTCATCTCGTCAAGGATGAACAGGACACAA
GCGCTTGACATGTTACCGTACTCACTCAACACTTGACGTGTGGCCTTCAG
CTTCTCCTCTTTGAGGCCGAGTTTAGACTCCACTTGGTCCAGAATTGCGG
GCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCAGTCGCTGATGCCA
ACCGGGGCGAACGCTTCCGACAGGCTTTTCTCTATATTCTTTGAGATCAA
GCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCGACTTCGCGCAAGT
GTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGAC
ACAAGCTGATACAACGGACGCTCGACCGACGTGTCAGGATCGGCACCCAC
GATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAAT
CAAGATGAGTATCGGCAGGGCCGCGGAAAGTGACCGCCGTGATCTCCGAA
CAGACAACAAGAACGCGAGCGCCCTTGTTGTTCTCAGCCAAGTCTTTAGC
GAGGCGAAGAACAGTGCCGCCGGCGAAACATCCTTGNTGGTACATCATG
back to top