CF835357
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF835357 vs. ExPASy Swiss-Prot
Match: SPEA_PROM3 (Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9303) GN=speA PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 2.306e-11 Identity = 37/103 (35.92%), Postives = 57/103 (55.34%), Query Frame = 3 Query: 3 KIDTFIGGG---TSLPLHEMVGGGCGERGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRVLQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPELMFETLKHRAE 302 K+D FIG G T L LH + + Y +GMFL GAY+E +G +HNLFG + V + + G + + + G + +VL M+H PE++ E L+ +E Sbjct: 520 KLDRFIGNGQTKTLLELHNL-----RQNEAYMIGMFLAGAYQEVMGNLHNLFGSTNAVHIRMTTG-GGYQIDHVVRGNTNSEVLEAMEHNPEILLERLRLASE 616
BLAST of CF835357 vs. ExPASy Swiss-Prot
Match: SPEA_PROMM (Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9313) GN=speA PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 6.708e-11 Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 3 Query: 3 KIDTFIGGG---TSLPLHEMVGGGCGERGPYYLGMFLGGAYEEALGGVHNLFGGPSVVRV-LQSDGPHSFAVTRAMPGPSCGDVLRVMQHEPELMFETLKHRAE 302 K+D FIG G T L LH + + Y +GMFL GAY+E +G +HNLFG + V + L + G + V + G + +VL M+H PEL+ E L+ +E Sbjct: 520 KLDRFIGNGQTKTLLELHNL-----RQNEAYMIGMFLAGAYQEVMGNLHNLFGSTNAVHIRLTTAG--GYQVDHVVRGNTNSEVLEAMEHNPELLLERLRLASE 616 The following BLAST results are available for this feature:
BLAST of CF835357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF835357 ID=CF835357; Name=CF835357; organism=Citrus sinensis; type=EST; length=719bpback to top |