CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_APIGR (Chlorophyll a-b binding protein, chloroplastic OS=Apium graveolens GN=LHC0 PE=1 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 4.258e-121
Identity = 203/219 (92.69%), Postives = 212/219 (96.80%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSIL+IWA QV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPE  AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   46 SPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILSIWATQVILMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPERSAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 264          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 7.263e-121
Identity = 203/219 (92.69%), Postives = 212/219 (96.80%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPWYG DRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFS+GGLDYLGNPSL+HAQS+LAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+ P+AFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE+LADH+ADPVNNNAW  ATNFVPGK
Sbjct:   48 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADPVNNNAWLIATNFVPGK 266          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 8.031e-120
Identity = 203/219 (92.69%), Postives = 211/219 (96.35%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            SPW+GPD VKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+ PEAFAELKVKE+KNGRLAMFSMFGFFV AIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct:   10 SPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSMFGFFVPAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 228          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.978e-118
Identity = 202/221 (91.40%), Postives = 211/221 (95.48%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYG DRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   47 GSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.978e-118
Identity = 202/221 (91.40%), Postives = 211/221 (95.48%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYG DRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:   47 GSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB23_POLMU (Chlorophyll a-b binding protein type 1 member F3, chloroplastic OS=Polystichum munitum GN=CABF3 PE=3 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.282e-117
Identity = 197/220 (89.55%), Postives = 208/220 (94.55%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GS WYG DR  YLGP SG PPSYL+GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCV PELLA+NGVKFGEAVWFKAG+QIF+EGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENL+DHLADP  NNAWAYATNF PGK
Sbjct:   46 GSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNNAWAYATNFTPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 421.779 bits (1083), Expect = 2.187e-117
Identity = 197/219 (89.95%), Postives = 208/219 (94.98%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG VEGYR+ GGPLGE  DP+YPGG+FDPLGLADDP+AFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL DHLADPV NNAWAYATNFVPGK
Sbjct:   47 SIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFVPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.851e-116
Identity = 198/206 (96.12%), Postives = 203/206 (98.54%), Query Frame = -3
Query:  137 PLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 754
            P SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH  WAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct:    1 PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSTWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 206          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB48_MAIZE (Chlorophyll a-b binding protein 48, chloroplastic OS=Zea mays GN=CAB48 PE=3 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 3.158e-116
Identity = 197/220 (89.55%), Postives = 203/220 (92.27%), Query Frame = -3
Query:  137 GSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 796
            GSPWYG DRV YLGPLSG PPSYLTGEFPGDYGWDT GLSADPETFAKNRELEVIHCRWA+   LGCVFPELLARNGVKFGE VWFKAG+QIFSEGGL + GNPSL+HAQSILAIWACQVVLMGAVEGY +AGG LGEV DPLY GGSFDPLGL DDPE FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHL DPVNNNAWAYATNFVPGK
Sbjct:   45 GSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAKNRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVHAQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNNAWAYATNFVPGK 264          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.956e-115
Identity = 192/219 (87.67%), Postives = 206/219 (94.06%), Query Frame = -3
Query:  137 SPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 793
            S WYG DR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWACQVVLMG VEGYR+ GGPLGE  D +YPGG+FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP+ENL+DH+ DPV NNAWAYATNFVPGK
Sbjct:   47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANNAWAYATNFVPGK 265          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB23_APIGR4.258e-12192.69Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_WHEAT7.263e-12192.69Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_PEA8.031e-12092.69Chlorophyll a-b binding protein AB96 (Fragment) OS... [more]
CB22_ARATH1.978e-11891.40Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_ARATH1.978e-11891.40Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB23_POLMU1.282e-11789.55Chlorophyll a-b binding protein type 1 member F3, ... [more]
CB21_GOSHI2.187e-11789.95Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB22_CUCSA1.851e-11696.12Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB48_MAIZE3.158e-11689.55Chlorophyll a-b binding protein 48, chloroplastic ... [more]
CB24_SOLLC5.956e-11587.67Chlorophyll a-b binding protein 4, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top