CF835384

Overview
NameCF835384
Unique NameCF835384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Washington Navel Orange Shoot Meristem cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:228..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2C_SOLLC (Chlorophyll a-b binding protein 1C, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1C PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 6.467e-61
Identity = 112/116 (96.55%), Postives = 115/116 (99.14%), Query Frame = -3
Query:  137 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 484
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2A_SOLLC (Chlorophyll a-b binding protein 1A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB1A PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 6.467e-61
Identity = 112/116 (96.55%), Postives = 115/116 (99.14%), Query Frame = -3
Query:  137 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 484
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:  150 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2F_SOLLC (Chlorophyll a-b binding protein 3B, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3B PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.103e-60
Identity = 111/116 (95.69%), Postives = 115/116 (99.14%), Query Frame = -3
Query:  137 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 484
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB2E_SOLLC (Chlorophyll a-b binding protein 3A, chloroplastic (Fragments) OS=Solanum lycopersicum GN=CAB3A PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.103e-60
Identity = 111/116 (95.69%), Postives = 115/116 (99.14%), Query Frame = -3
Query:  137 SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 484
            SL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct:  152 SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK 267          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.032e-58
Identity = 111/124 (89.52%), Postives = 115/124 (92.74%), Query Frame = -3
Query:  137 LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 505
            LDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPL    DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct:    1 LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLASLTDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 124          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.657e-54
Identity = 118/209 (56.46%), Postives = 138/209 (66.03%), Query Frame = -3
Query:  173 WYGPDRVKYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 787
            WYGPDR  +L  G L   E P YL GE  GDYG+D  GL   PE FAK +  E+IH RWAMLGA G + PE L + G   G EAVWFK GA +     L+Y G    I+   +LA+ A +VVL+G  E YRI  G   +  D L+PGG FDPLGLA DPE  A LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   62 WYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VLAVVA-EVVLLGGAEYYRITNGL--DFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNN 265          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB21_EUGGR (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.802e-34
Identity = 77/118 (65.25%), Postives = 86/118 (72.88%), Query Frame = -3
Query:  143 SLIHAQSILAIWACQVVLMGAVEGYRI---AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP-VNNNAWAYATNFVP 484
            +LIHA+S+LAI A QV+LMGAVEGYR    A G  GE  D LYPGG FDPLGLADDP+ F ELKVKEIKNGRLAM  M GF+ QAIVTG+GP+EN   HL DP  +N   A  T F P
Sbjct:    4 ALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDPDTFPELKVKEIKNGRLAMSGMLGFYAQAIVTGEGPVENWLYHLQDPSAHNGLTALVTQFAP 121          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.501e-33
Identity = 88/196 (44.90%), Postives = 111/196 (56.63%), Query Frame = -3
Query:  173 LSGEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGG-LDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV-QAIVTGKGPLENLADHLADPVNNN 751
            + G+P PSYL G  PGD+G+D+ GL   P    + +E E+IHCRWAML   G + PE L       G   W KA       GG   YLG P  +   ++  I A + + +  VE  R       +     YPGG+FDPLG + DP  F ELKVKEIKNGRLA+ ++ GF V Q+   G GPLENLA HLADP +NN
Sbjct:   50 MPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVPEAL-------GLGNWVKAQEWAAIPGGQATYLGQP--VPWGTLPTILAIEFLAIAFVEHQRSMEK---DSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNN 233          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.368e-33
Identity = 86/194 (44.33%), Postives = 110/194 (56.70%), Query Frame = -3
Query:  173 GEP-PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGA-QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV-QAIVTGKGPLENLADHLADPVNNN 745
            G+P P++L G  PGD+G+D  GL+  PE F + +E E+ HCRWAML   G + PE L       G   W KA       +G   YLGNP  +   ++  I A + + +   E  R       +     YPGG+FDPLG + DP  F ELK+KEIKNGRLAM +  GF V Q+   G GPLENLA HLADP +NN
Sbjct:   51 GQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEAL-------GLGNWVKAQEWAALPDGQATYLGNP--VPWGNLPTILAIEFLAIAFAEQQRTMEK---DPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 232          
BLAST of CF835384 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.698e-32
Identity = 80/192 (41.67%), Postives = 107/192 (55.73%), Query Frame = -3
Query:  185 PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA-----CQVVLMGAVEGYRIAGGPLGEVTDPLYPGGS-FDPLGL-ADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADP 739
            PP +L G  PGD+G+D  GL++DPE+   N++ E++HCRWAMLGA G   PELL + G+      W+ AG Q +      +    +L   + +L  WA       ++  G V    I        TD  YPGG  FDPLG  +  P    EL+ KEIKNGRLAM ++ G + Q I TG GP++NL  HLADP
Sbjct:   74 PPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGI-LNTPSWYTAGEQEY------FTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADP 258          
The following BLAST results are available for this feature:
BLAST of CF835384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 84
Match NameE-valueIdentityDescription
CB2C_SOLLC6.467e-6196.55Chlorophyll a-b binding protein 1C, chloroplastic ... [more]
CB2A_SOLLC6.467e-6196.55Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB2F_SOLLC1.103e-6095.69Chlorophyll a-b binding protein 3B, chloroplastic ... [more]
CB2E_SOLLC1.103e-6095.69Chlorophyll a-b binding protein 3A, chloroplastic ... [more]
CB21_RAPSA1.032e-5889.52Chlorophyll a-b binding of LHCII type 1 protein (F... [more]
CB26_ARATH7.657e-5456.46Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB21_EUGGR8.802e-3465.25Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB11_SOLLC1.501e-3344.90Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB121_HORVU4.368e-3344.33Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB12_SOLLC3.698e-3241.67Chlorophyll a-b binding protein 7, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS03_01C11_f Washington Navel Orange Shoot Meristem cDNA Library Citrus sinensis cDNA clone CS_PEa01C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835384 ID=CF835384|Name=CF835384|organism=Citrus sinensis|type=EST|length=798bp
TTTTTTTTTTTTTTTTGATCAATTGAAGCATTTTATAAATAACCATTACT
CAAATTAAAGCTTCCATGAGCTCACAACAGATTTACATGATATCCAAGAA
ACCGAAAAGAGAAAAACTCTTATCAACCGAAGCTCACTTTCCGGGGACAA
AGTTGGTGGCGTAGGCCCAGGCATTGTTATTGACAGGGTCAGCCAAGTGG
TCGGCCAAGTTCTCTAACGGTCCCTTGCCGGTGACAATGGCCTGAACGAA
GAAACCAAACATGGAGAACATAGCCAACCTTCCATTCTTGATTTCCTTAA
CCTTGAGCTCAGCAAAAGCCTCCGGGTCATCAGCCAAACCCAATGGATCA
AAGCTGCCACCTGGGTACAATGGGTCAGTCACTTCACCGAGCGGCCCTCC
AGCAATTCTGTAACCCTCAACGGCTCCCATCAAGACCACCTGGCAAGCCC
AGATGGCCAAGATGCTCTGGGCGTGGATCAAGCTTGGGTTTCCCAAGTAG
TCAAGCCCGCCCTCGCTGAAGATCTGAGCTCCCGCCTTGAACCACACAGC
CTCACCGAACTTGACTCCGTTGCGGGCCAAGAGCTCCGGGAAGACGCATC
CAAGAGCTCCCAACATGGCCCATCTGCAGTGGATGACTTCGAGTTCACGG
TTCTTGGCAAAGGTTTCTGGGTCAGCTGAAAGCCCGGCAGTGTCCCAACC
GTAGTCGCCAGGGAACTCACCAGTCAAGTAGCTTGGGGGCTCGCCAGAGA
GTGGGCCCAAGTACTTGACTCTGTCCGGGCCGTACCACGGGCTACCTG
back to top