CF835769
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF835769 vs. ExPASy Swiss-Prot
Match: THIO_CHLAA (Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3) HSP 1 Score: 67.781 bits (164), Expect = 5.737e-11 Identity = 35/89 (39.33%), Postives = 55/89 (61.80%), Query Frame = 2 Query: 149 QKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFL-KVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTI 412 +K ++K VVVDF A WCGPCR IAP L +LA + L + KV+ D+ A+ ++ +PT + K+G+ V ++VGA+ E + + I Sbjct: 14 EKVLKSKTPVVVDFWAPWCGPCRVIAPILDKLAGEYAGRLTIAKVNTDDNVQYASQLGIQGIPTLVIFKDGREVGRLVGARPEAMYREI 102
BLAST of CF835769 vs. ExPASy Swiss-Prot
Match: THIO1_DROME (Thioredoxin-1 OS=Drosophila melanogaster GN=dhd PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.492e-11 Identity = 31/100 (31.00%), Postives = 65/100 (65.00%), Query Frame = 2 Query: 122 TVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPN-VLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTIAK 418 T+ ++++++ +++ +L+V+DF A+WCGPC+ + + LA+K + + LK+DVD+ + + + V +MPTF+FL++ + + GA + +L +AK Sbjct: 6 TMNDYHKRIEAADD--KLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103 The following BLAST results are available for this feature:
BLAST of CF835769 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 112
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF835769 ID=CF835769; Name=CF835769; organism=Citrus sinensis; type=EST; length=655bpback to top |