CF835786
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACHK (Chaperone protein dnaJ OS=Bacillus thuringiensis subsp. konkukian GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACCZ (Chaperone protein dnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACCQ (Chaperone protein dnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACC7 (Chaperone protein dnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACC3 (Chaperone protein dnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACC1 (Chaperone protein dnaJ OS=Bacillus cereus (strain ATCC 10987) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACC0 (Chaperone protein dnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACAN (Chaperone protein dnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACAC (Chaperone protein dnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67
BLAST of CF835786 vs. ExPASy Swiss-Prot
Match: DNAJ_BACAA (Chaperone protein dnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 2 Query: 248 YEILGIQTGATCQEIKTAYRKLARVLHPDVAAKSQNENSAYKFMKLHEAYETLSDPKKRADYDR 439 YE+LG+ GA+ EIK AYR+LA+ HPDV S+ EN+ KF ++ EAYE LSD +KRA YD+ Sbjct: 7 YEVLGLSKGASKDEIKKAYRRLAKKYHPDV---SKEENAIEKFKEVQEAYEVLSDDQKRAQYDQ 67 The following BLAST results are available for this feature:
BLAST of CF835786 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 37
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF835786 ID=CF835786; Name=CF835786; organism=Citrus sinensis; type=EST; length=685bpback to top |