CF836005
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF836005 vs. ExPASy Swiss-Prot
Match: RS8_METMA (30S ribosomal protein S8P OS=Methanosarcina mazei GN=rps8p PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 3 Query: 63 MVIVSVLNDALKSMYNAEKRGKRQVMI*PSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLN*CG 281 MV++ L +AL ++ NAE GK ++ P+SK I L VMQ GYIG+FE++DD +AG V L GR+N CG Sbjct: 1 MVLLDPLANALSTIKNAEAIGKSSCIVRPASKNIGNVLKVMQDLGYIGDFEFIDDGKAGIYSVTLVGRINKCG 73
BLAST of CF836005 vs. ExPASy Swiss-Prot
Match: RS8_METAC (30S ribosomal protein S8P OS=Methanosarcina acetivorans GN=rps8p PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.670e-11 Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 3 Query: 63 MVIVSVLNDALKSMYNAEKRGKRQVMI*PSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLN*CG 281 MV++ L +AL ++ NAE GK ++ P+SK I L VMQ GYIG+FE++DD +AG V L GR+N CG Sbjct: 1 MVLLDPLANALSTIKNAEAIGKSSCVVRPASKNIGNVLKVMQDLGYIGDFEFIDDGKAGIYSVTLVGRINKCG 73 The following BLAST results are available for this feature:
BLAST of CF836005 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF836005 ID=CF836005; Name=CF836005; organism=Citrus sinensis; type=EST; length=284bpback to top |