CF836069
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF836069 vs. ExPASy Swiss-Prot
Match: WRK58_ARATH (Probable WRKY transcription factor 58 OS=Arabidopsis thaliana GN=WRKY58 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 8.907e-15 Identity = 35/58 (60.34%), Postives = 41/58 (70.69%), Query Frame = 2 Query: 611 NYQHQQSQPIRESKKSDDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSLD 784 N ++ + K +DDGYNWRKYGQK +KG E PRSYYKCT +CP KKKVERS D Sbjct: 151 NNNNRSYNVVNVDKPADDGYNWRKYGQKPIKGCEYPRSYYKCTHVNCPVKKKVERSSD 208 HSP 2 Score: 68.9366 bits (167), Expect = 3.502e-11 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 659 DDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERS 778 DDGY WRKYGQK VKG+ +PRSYYKCT P+C +K VER+ Sbjct: 306 DDGYRWRKYGQKVVKGNPHPRSYYKCTTPNCTVRKHVERA 345
BLAST of CF836069 vs. ExPASy Swiss-Prot
Match: WRK49_ARATH (Probable WRKY transcription factor 49 OS=Arabidopsis thaliana GN=WRKY49 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 8.336e-13 Identity = 31/42 (73.81%), Postives = 34/42 (80.95%), Query Frame = 2 Query: 659 DDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSLD 784 DDGY WRKYGQK +K S NPRSYYKCT P C KK+VERS+D Sbjct: 114 DDGYKWRKYGQKSIKNSPNPRSYYKCTNPICNAKKQVERSID 155
BLAST of CF836069 vs. ExPASy Swiss-Prot
Match: WRKY1_ARATH (WRKY transcription factor 1 OS=Arabidopsis thaliana GN=WRKY1 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 9.217e-12 Identity = 30/50 (60.00%), Postives = 37/50 (74.00%), Query Frame = 2 Query: 629 SQPIRESKKSDDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERS 778 + P K +DGYNWRKYGQK VKG+E RSYY+CT P+C KK++ERS Sbjct: 101 NSPFIREKVMEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERS 150 HSP 2 Score: 70.0922 bits (170), Expect = 1.572e-11 Identity = 29/40 (72.50%), Postives = 32/40 (80.00%), Query Frame = 2 Query: 659 DDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERS 778 +DGY WRKYGQK VKGS PRSYY+C+ P CP KK VERS Sbjct: 307 NDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERS 346 The following BLAST results are available for this feature:
BLAST of CF836069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF836069 ID=CF836069; Name=CF836069; organism=Citrus sinensis; type=EST; length=785bpback to top |